---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SUR2/YDR297W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIV: 1056548 to 1057597 CDS: 1056548 - 1057597 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SUR2	YDR297W	SYR2	ORF, Verified	S000002705
Description
Sphinganine C4-hydroxylase, catalyses the conversion of sphinganine to phytosphingosine in sphingolipid biosyntheis

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By iron ion binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006694 Assigned on 2009-01-12 UniProtKB oxidoreductase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006694 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2008-02-14 UniProtKB sphingosine hydroxylase activity Grilley MM, et al. (1998) Syringomycin action gene SYR2 is essential for sphingolipid 4-hydroxylation in Saccharomyces cerevisiae. J Biol Chem 273(18):11062-8        ISS : Inferred from Sequence or structural Similarity IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By fatty acid biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006694 Assigned on 2009-01-12 UniProtKB lipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0444 Assigned on 2008-02-14 UniProtKB oxidation reduction DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006694 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2008-05-21 UniProtKB peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT sphingolipid metabolic process Grilley MM, et al. (1998) Syringomycin action gene SYR2 is essential for sphingolipid 4-hydroxylation in Saccharomyces cerevisiae. J Biol Chem 273(18):11062-8        ISS : Inferred from Sequence or structural Similarity IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006694 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2008-02-14 UniProtKB endoplasmic reticulum membrane Cliften P, et al. (1996) SYR2, a gene necessary for syringomycin growth inhibition of Saccharomyces cerevisiae. Microbiology 142 ( Pt 3):477-84      IDA : Inferred from Direct Assay Assigned on 2009-04-29 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
sphingolipid metabolism

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for SUR2/YDR297W for SUR2 About sphingolipid metabolism Sphingolipids are essential components of the plasma membrane in all eukaryotic cells. S. cerevisiae cells make three complex sphingolipids: inositol-phosphoceramide (IPC), mannose-inositol-phosphoceramide (MIPC), and mannose-(inositol phosphate)2-ceramide (M(IP)2C)(1). In the yeast plasma membrane sphingolipids concentrate with ergosterol to form lipid rafts, specialized membrane microdomains implicated in a variety of cellular processes, including sorting of membrane proteins and lipids, as well as organizing and regulating signaling cascades (2). Intermediates in sphingolipid biosynthesis have been shown to play important roles as signaling molecules and growth regulators. Sphingolipid long chain bases (LCBs), dihydrosphingosine (DHS) and phytosphingosine (PHS), have been implicated as secondary messengers in signaling pathways that regulate heat stress response (3, 4). Other intermediates, phytoceramide and long-chain base phosphates (LCBPs), have been shown to be components of the tightly-controlled ceramide/LCBP rheostat, which regulates cell growth (5). Since phosphoinositol-containing sphingolipids are unique to fungi, the sphingolipid biosynthesis pathway is considered a target for antifungal drugs (6, 7). Last Updated: 2007-10-05

Basic References [TOP]

BASIC INFORMATION REFERENCES forSUR2/YDR297W for SUR2 1) Dickson RC and Lester RL (2002) Sphingolipid functions in Saccharomyces cerevisiae. Biochim Biophys Acta 1583(1):13-25            2) Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80        3) Jenkins GM, et al. (1997) Involvement of yeast sphingolipids in the heat stress response of Saccharomyces cerevisiae. J Biol Chem 272(51):32566-72        4) Ferguson-Yankey SR, et al. (2002) Mutant analysis reveals complex regulation of sphingolipid long chain base phosphates and long chain bases during heat stress in yeast. Yeast 19(7):573-86      5) Kobayashi SD and Nagiec MM (2003) Ceramide/long-chain base phosphate rheostat in Saccharomyces cerevisiae: regulation of ceramide synthesis by Elo3p and Cka2p. Eukaryot Cell 2(2):284-94        6) Nagiec MM, et al. (1997) Sphingolipid synthesis as a target for antifungal drugs. Complementation of the inositol phosphorylceramide synthase defect in a mutant strain of Saccharomyces cerevisiae by the AUR1 gene. J Biol Chem 272(15):9809-17        7) Sugimoto Y, et al. (2004) IPC synthase as a useful target for antifungal drugs. Curr Drug Targets Infect Disord 4(4):311-22        8) Grilley MM, et al. (1998) Syringomycin action gene SYR2 is essential for sphingolipid 4-hydroxylation in Saccharomyces cerevisiae. J Biol Chem 273(18):11062-8        9) Haak D, et al. (1997) Hydroxylation of Saccharomyces cerevisiae ceramides requires Sur2p and Scs7p. J Biol Chem 272(47):29704-10        10) Bae JH, et al. (2004) Cloning and functional characterization of the SUR2/SYR2 gene encoding sphinganine hydroxylase in Pichia ciferrii. Yeast 21(5):437-43        11) Desfarges L, et al. (1993) Yeast mutants affected in viability upon starvation have a modified phospholipid composition. Yeast 9(3):267-77

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SUR2/YDR297W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SUR2/YDR297W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MNVTSNA C-term NEVKKEK Length(aa) 349 MW(Da) 40,734 pI 8.95 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.224   Codon Adaptation Index 0.209   Frequency of Optimal Codons 0.544   Hydropathicity of Protein -0.107   Aromaticity Score 0.155	10 20 30 40 50 | | | | | MNVTSNATAAGSFPLAFGLKTSFGFMHYAKAPAINLRPKESLLPEMSDGV LALVAPVVAYWALSGIFHVIDTFHLAEKYRIHPSEEVAKRNKASRMHVFL EVILQHIIQTIVGLIFMHFEPIYMTGFEENAMWKLRADLPRIIPDAAIYY GYMYGMSALKIFAGFLFVDTWQYFLHRLMHMNKTLYKWFHSVHHELYVPY AYGALFNNPVEGFLLDTLGTGIAMTLTHLTHREQIILFTFATMKTVDDHC GYALPLDPFQWLFPNNAVYHDIHHQQFGIKTNFAQPFFTFWDNLFQTNFK GFEEYQKKQRRVTIDKYKEFLQERELEKKEKLKNFKAMNAAENEVKKEK*

Protein Structures from PDB: proteins of known structure with sequence similarity to SUR2/YDR297W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SUR2	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YDR297W	SGD Systematic Sequence
851891	NCBI: Gene ID
NP_010583.1	NCBI: RefSeq protein version ID
NP_010583.1	NCBI: RefSeq protein version ID
6320503	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]

DNA & RNA Details Topic Research Highlight Reference Contributor Other DNA & RNA Details Description: Specifically lower expression in sulfur limited chemostat cultures versus sulfur excess. otherTopic: expression Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74            Viktor Boer 2003-07-25

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
51 curated references; 0 references not yet curated
Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents	Bosson R, et al. (2009) Incorporation of ceramides into Saccharomyces cerevisiae glycosylphosphatidylinositol-anchored proteins can be monitored in vitro. Eukaryot Cell 8(3):306-14	|CWH43 |GUP1 |MCD4 |SCS7
Disease Gene Related Reviews	Ozbayraktar FB and Ulgen KO (2009) Molecular facets of sphingolipids: mediators of diseases. Biotechnol J 4(7):1028-41	|AUR1 |CSG2 |CSH1 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB4 |LCB5 |SCS7 |SUR1 |TSC10 |MORE
Reviews	Dickson RC (2008) Thematic Review Series: Sphingolipids. New insights into sphingolipid metabolism and function in budding yeast. J Lipid Res 49(5):909-21	|AUR1 |CSG2 |CSH1 |DPL1 |FEN1 |IFA38 |IPT1 |ISC1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |MORE
Mutants/Phenotypes	Herrero AB, et al. (2008) Levels of SCS7/FA2H-Mediated Fatty Acid 2-Hydroxylation Determine the Sensitivity of Cells to Antitumor PM02734. Cancer Res 68(23):9779-87	|AIM44 |ALD6 |ALG6 |API2 |APL1 |APL5 |APM3 |ATP15 |ATP4 |ATP5 |ATP7 |BRE5 |BST1 |CAT5 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Brace JL, et al. (2007) SVF1 regulates cell survival by affecting sphingolipid metabolism in Saccharomyces cerevisiae. Genetics 175(1):65-76	|DPL1 |LCB3 |LCB4 |SVF1 |YPK1
Cross-species Expression Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Imamura T, et al. (2007) A Rice Dihydrosphingosine C4 Hydroxylase (DSH1) Gene, which is Abundantly Expressed in the Stigmas, Vascular Cells and Apical Meristem, may be Involved in Fertility. Plant Cell Physiol 48(8):1108-20
Reviews	Kihara A, et al. (2007) Metabolism and biological functions of two phosphorylated sphingolipids, sphingosine 1-phosphate and ceramide 1-phosphate. Prog Lipid Res 46(2):126-44	|DPL1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |TSC10 |TSC3 |YDC1 |YPC1 |YSR3
Fungal Related Genes/Proteins	Li S, et al. (2007) basA Regulates Cell Wall Organization and Asexual/Sexual Sporulation Ratio in Aspergillus nidulans. Genetics 176(1):243-53
Reviews	Dickson RC, et al. (2006) Functions and metabolism of sphingolipids in Saccharomyces cerevisiae. Prog Lipid Res 45(6):447-65	|ARV1 |AUR1 |CSH1 |DPL1 |FEN1 |IPT1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |NCR1 |PKH1 |PKH2 |MORE
Mutants/Phenotypes Techniques and Reagents	Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109	|ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Regulation of Transcription	Fry RC, et al. (2006) The DNA-damage signature in Saccharomyces cerevisiae is associated with single-strand breaks in DNA. BMC Genomics 7():313	|AAH1 |AHP1 |ALG14 |AMN1 |ASF1 |BAT1 |BUD4 |CAC2 |CAR1 |CDC42 |CDC8 |CHA1 |CHS2 |CIC1 |MORE
Reviews	Riezman H (2006) Organization and functions of sphingolipid biosynthesis in yeast. Biochem Soc Trans 34(3):367-369	|AUR1 |CSG2 |DPL1 |IPT1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |SUR1 |TSC3 |MORE
Cross-species Expression Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Ternes P, et al. (2006) Identification of fungal sphingolipid C9-methyltransferases by phylogenetic profiling. J Biol Chem 281(9):5582-92
Cellular Location Strains/Constructs	Voeltz GK, et al. (2006) A class of membrane proteins shaping the tubular endoplasmic reticulum. Cell 124(3):573-86	|ERG3 |ERP2 |OST1 |RTN1 |RTN2 |SEC63 |WBP1 |YOP1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22	|ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |CSG2 |DPL1 |ELO1 |ERG24 |ERG3 |ERG4 |ERG5 |FEN1 |HEM1 |MORE
Mutants/Phenotypes Strains/Constructs	Kaulin YA, et al. (2005) Sphingolipids influence the sensitivity of lipid bilayers to fungicide, syringomycin E. J Bioenerg Biomembr 37(5):339-48
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kobayashi T, et al. (2005) Disturbance of sphingolipid biosynthesis abrogates the signaling of Mss4, phosphatidylinositol-4-phosphate 5-kinase, in yeast. J Biol Chem 280(18):18087-94	|CSG2 |IPT1 |MSS4 |PLC1 |RHO1 |RHO2 |ROM2
RNA Levels and Processing Regulation of	Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91	|AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Proszynski TJ, et al. (2005) A genome-wide visual screen reveals a role for sphingolipids and ergosterol in cell surface delivery in yeast. Proc Natl Acad Sci U S A 102(50):17981-6	|AYR1 |BUD27 |CCZ1 |CHS5 |ERG4 |ERG6 |FAB1 |GIM3 |KES1 |LCB1 |MCH5 |MON1 |OPI9 |PAC10 |MORE
Function/Process Fungal Related Genes/Proteins Substrates/Ligands/Cofactors	Bae JH, et al. (2004) Cloning and functional characterization of the SUR2/SYR2 gene encoding sphinganine hydroxylase in Pichia ciferrii. Yeast 21(5):437-43
Mutants/Phenotypes Strains/Constructs	Baetz K, et al. (2004) Yeast genome-wide drug-induced haploinsufficiency screen to determine drug mode of action. Proc Natl Acad Sci U S A 101(13):4525-30	|CSG2 |LCB1 |LCB2 |PKH1 |TSC10 |YPK1
DNA/RNA Sequence Features Regulation of	Kolaczkowski M, et al. (2004) Differential regulation of ceramide synthase components LAC1 and LAG1 in Saccharomyces cerevisiae. Eukaryot Cell 3(4):880-92	|CBF1 |LAC1 |LAG1 |LCB2 |PDR1 |PDR3 |ROX1
Cross-species Expression Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Beckmann C, et al. (2003) Stereochemistry of a bifunctional dihydroceramide delta 4-desaturase/hydroxylase from Candida albicans; a key enzyme of sphingolipid metabolism. Org Biomol Chem 1(14):2448-54
Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Idkowiak-Baldys J, et al. (2003) Structure-function studies of yeast C-4 sphingolipid long chain base hydroxylase. Biochim Biophys Acta 1618(1):17-24	|ERG3
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Ooi SL, et al. (2003) DNA helicase gene interaction network defined using synthetic lethality analyzed by microarray. Nat Genet 35(3):277-86	|CSM3 |MRC1 |RAD27 |RAD51 |RAD9 |RNH203 |RRM3 |SGS1 |SLX9 |SRS2 |TOF1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Uemura S, et al. (2003) Csg1p and newly identified Csh1p function in mannosylinositol phosphorylceramide synthesis by interacting with Csg2p. J Biol Chem 278(46):45049-55	|CSG2 |CSH1 |IPT1 |SCS7 |SUR1
Reviews	Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80	|AUR1 |CSG2 |IPT1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |SUR1 |TSC10 |YSR3
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Balguerie A, et al. (2002) Rvs161p and sphingolipids are required for actin repolarization following salt stress. Eukaryot Cell 1(6):1021-31	|ACT1 |FEN1 |IPT1 |RVS161 |SLG1 |SUR1 |SUR4
Reviews	Funato K, et al. (2002) Biosynthesis and trafficking of sphingolipids in the yeast Saccharomyces cerevisiae. Biochemistry 41(51):15105-14	|ACB1 |AUR1 |CCC2 |CSG2 |DPL1 |ELO1 |FEN1 |FMP45 |IFA38 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |MORE
Function/Process	Hanada K and Hirabayashi Y (2002) [Biosynthesis of sphingolipids] Tanpakushitsu Kakusan Koso 47(4 Suppl):403-8
Function/Process Reviews	Obeid LM, et al. (2002) Yeast sphingolipids: metabolism and biology. Biochim Biophys Acta 1585(2-3):163-71	|CSG2 |FEN1 |LCB4 |LCB5 |SUR1 |SUR4
Function/Process	Swain E, et al. (2002) Sterol-dependent regulation of sphingolipid metabolism in Saccharomyces cerevisiae. J Biol Chem 277(29):26177-84	|CCC2 |ERG26 |LCB3 |SCS7
Cross-species Expression Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Strains/Constructs	Ternes P, et al. (2002) Identification and characterization of a sphingolipid delta 4-desaturase family. J Biol Chem 277(28):25512-8
Mutants/Phenotypes Strains/Constructs	Abe M, et al. (2001) Yeast 1,3-beta-glucan synthase activity is inhibited by phytosphingosine localized to the endoplasmic reticulum. J Biol Chem 276(29):26923-30	|FEN1
Alias Cell Growth and Metabolism Function/Process Mutants/Phenotypes Strains/Constructs	Chung N, et al. (2001) Phytosphingosine as a specific inhibitor of growth and nutrient import in Saccharomyces cerevisiae. J Biol Chem 276(38):35614-21	|DPL1 |FEN1 |HIS4 |LCB4 |LCB5 |LEU2 |TRP1
DNA/RNA Sequence Features Regulation of Transcription	Iyer VR, et al. (2001) Genomic binding sites of the yeast cell-cycle transcription factors SBF and MBF. Nature 409(6819):533-8	|ABF1 |APN1 |BBP1 |BUD9 |CAP1 |CDC21 |CDC45 |CDC7 |CLA4 |CLB1 |CLB2 |CLB6 |CLD1 |CLN1 |MORE
Alias Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Jenkins GM and Hannun YA (2001) Role for de novo sphingoid base biosynthesis in the heat-induced transient cell cycle arrest of Saccharomyces cerevisiae. J Biol Chem 276(11):8574-81	|CLN3 |DOA1 |LCB1 |LCB4 |LCB5
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Sperling P, et al. (2001) Functional characterization of sphingolipid C4-hydroxylase genes from Arabidopsis thaliana. FEBS Lett 494(1-2):90-4	|ERG3
Techniques and Reagents	Chung N and Obeid LM (2000) Use of yeast as a model system for studies of sphingolipid metabolism and signaling. Methods Enzymol 311():319-31	|FEN1 |LCB4 |LCB5 |SUR4
Techniques and Reagents	Grilley MM and Takemoto JY (2000) Assay of the Saccharomyces cerevisiae dihydrosphingosine C-4 hydroxylase. Methods Enzymol 311:9-14
Genetic Interactions Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Kim S, et al. (2000) Accumulation of phosphorylated sphingoid long chain bases results in cell growth inhibition in Saccharomyces cerevisiae. Genetics 156(4):1519-29	|DPL1 |LCB3 |LCB4 |LCB5 |YSR3
Alias Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Sperling P, et al. (2000) Further characterization of Delta(8)-sphingolipid desaturases from higher plants. Biochem Soc Trans 28(6):638-41
Alias Cell Cycle Phase Involved Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features RNA Levels and Processing Reviews Strains/Constructs Substrates/Ligands/Cofactors	Dickson RC and Lester RL (1999) Metabolism and selected functions of sphingolipids in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1438(3):305-21	|AUR1 |CSG2 |DPL1 |ERG2 |FAS2 |FEN1 |IPT1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |MSN2 |MSN4 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Beeler T, et al. (1998) The Saccharomyces cerevisiae TSC10/YBR265w gene encoding 3-ketosphinganine reductase is identified in a screen for temperature-sensitive suppressors of the Ca2+-sensitive csg2Delta mutant. J Biol Chem 273(46):30688-94	|CSG2 |FAS2 |LCB1 |LCB2 |MSS4 |RPD3 |SIN3 |TOR2 |TSC10 |TSC11 |TSC13 |TSC3
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Alias Reviews	Dickson RC (1998) Sphingolipid functions in Saccharomyces cerevisiae: comparison to mammals. Annu Rev Biochem 67:27-48	|CSG2 |DPL1 |IPT1 |LCB1 |LCB2 |LCB3 |SAC1
Alias Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Grilley MM, et al. (1998) Syringomycin action gene SYR2 is essential for sphingolipid 4-hydroxylation in Saccharomyces cerevisiae. J Biol Chem 273(18):11062-8
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Haak D, et al. (1997) Hydroxylation of Saccharomyces cerevisiae ceramides requires Sur2p and Scs7p. J Biol Chem 272(47):29704-10	|CSG2 |SCS7 |SUR1
Alias Cellular Location DNA/RNA Sequence Features Mutants/Phenotypes Other Features Protein Sequence Features Strains/Constructs	Cliften P, et al. (1996) SYR2, a gene necessary for syringomycin growth inhibition of Saccharomyces cerevisiae. Microbiology 142 ( Pt 3):477-84
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Desfarges L, et al. (1993) Yeast mutants affected in viability upon starvation have a modified phospholipid composition. Yeast 9(3):267-77	|RVS161 |RVS167 |SUR1 |SUR3 |SUR4
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Other Features Strains/Constructs	Takemoto JY, et al. (1993) Yeast genes involved in growth inhibition by Pseudomonas syringae pv. syringae syringomycin family lipodepsipeptides. FEMS Microbiol Lett 114(3):339-42

Return to SGD

Send a Message to the SGD Curators