---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SLY1/YDR189W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIV: 838390 to 840390 CDS: 838390 - 840390 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SLY1	YDR189W		ORF, Verified	S000002597
Description
Hydrophilic protein involved in vesicle trafficking between the ER and Golgi; SM (Sec1/Munc-18) family protein that binds the tSNARE Sed5p and stimulates its assembly into a trans-SNARE membrane-protein complex

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By SNARE binding Li Y, et al. (2005) Structure-based functional analysis reveals a role for the SM protein Sly1p in retrograde transport to the endoplasmic reticulum. Mol Biol Cell 16(9):3951-62        IDA : Inferred from Direct Assay Assigned on 2008-02-14 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By ER to Golgi vesicle-mediated transport Cao X, et al. (1998) Initial docking of ER-derived vesicles requires Uso1p and Ypt1p but is independent of SNARE proteins. EMBO J 17(8):2156-65        IMP : Inferred from Mutant Phenotype Assigned on 2002-08-27 SGD establishment of protein localization Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT intracellular protein transport Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc membrane fusion Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc protein retention in Golgi apparatus Kamena F, et al. (2008) Ypt1p is essential for retrograde Golgi-ER transport and for Golgi maintenance in S. cerevisiae. J Cell Sci 121(Pt 8):1293-302        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction with SGD:YPT1 Assigned on 2008-09-11 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc retrograde vesicle-mediated transport, Golgi to ER Li Y, et al. (2005) Structure-based functional analysis reveals a role for the SM protein Sly1p in retrograde transport to the endoplasmic reticulum. Mol Biol Cell 16(9):3951-62        IMP : Inferred from Mutant Phenotype Assigned on 2008-02-14 SGD transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB vesicle docking during exocytosis DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001619 Assigned on 2007-05-23 UniProtKB vesicle-mediated transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001619 Assigned on 2007-05-23 UniProtKB Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By ER to Golgi transport vesicle Cao X and Barlowe C (2000) Asymmetric requirements for a Rab GTPase and SNARE proteins in fusion of COPII vesicles with acceptor membranes. J Cell Biol 149(1):55-66        IDA : Inferred from Direct Assay Assigned on 2002-08-27 SGD Golgi apparatus Cao X and Barlowe C (2000) Asymmetric requirements for a Rab GTPase and SNARE proteins in fusion of COPII vesicles with acceptor membranes. J Cell Biol 149(1):55-66        IDA : Inferred from Direct Assay Assigned on 2002-08-27 SGD cytoplasm GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0963 Assigned on 2008-02-14 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0086 Assigned on 2008-02-13 UniProtKB endoplasmic reticulum Cao X and Barlowe C (2000) Asymmetric requirements for a Rab GTPase and SNARE proteins in fusion of COPII vesicles with acceptor membranes. J Cell Biol 149(1):55-66        IDA : Inferred from Direct Assay Assigned on 2002-08-27 SGD extrinsic to membrane GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9903 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forSLY1/YDR189W for SLY1 1) Cao X, et al. (1998) Initial docking of ER-derived vesicles requires Uso1p and Ypt1p but is independent of SNARE proteins. EMBO J 17(8):2156-65        2) Kosodo Y, et al. (2003) Cooperation of Sly1/SM-family protein and sec18/NSF of Saccharomyces cerevisiae in disassembly of cis-SNARE membrane-protein complexes. Biosci Biotechnol Biochem 67(2):448-50

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SLY1/YDR189W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SLY1/YDR189W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MAVEEIA C-term NSSNNDA Length(aa) 666 MW(Da) 74,678 pI 4.94 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.169   Codon Adaptation Index 0.188   Frequency of Optimal Codons 0.518   Hydropathicity of Protein -0.331   Aromaticity Score 0.078

10 20 30 40 50 | | | | | MAVEEIASRKDISLRDMQISAILKMLFLNKDLNNNDNITTITDDIFNQQE IIWKVLILDIKSTATISSVLRVNDLLKAGITVHSLIKQDRSPLPDVPAIY FVSPTKENIDIIVNDLKSDKYSEFYINFTSSLPRNLLEDLAQQVSITGKS DKIKQVYDQYLDFIVTEPELFSLEISNAYLTLNDPKTTEEEITGLCANIA DGLFNTVLTINSIPIIRAAKGGPAEIIAEKLGTKLRDFVINTNSSSTSTL QGNDSLERGVLIILDRNIDFASMFSHSWIYQCMVFDIFKLSRNTVTIPLE SKENGTDNTTAKPLATKKYDIEPNDFFWMENSHLPFPEAAENVEAALNTY KEEAAEITRKTGVTNISDLDPNSNNDTVQIQEVVKKLPELTAKKNTIDTH MNIFAALLSQLESKSLDTFFEVEQDPGSTKTRSRFLDILKDGKTNNLEDK LRSFIVLYLTSTTGLPKDFVQNVENYFKENDYDINALKYVYKLREFMQLS NMSLQNKSLEDGSDSAFKPSNLTLSGIYGLTEGKLQGGVGSLISGIKKLL PEKKTIPITNVVDAIMDPLNSSQKNLETTDSYLYIDPKITRGSHTRKPKR QSYNKSLVFVVGGGNYLEYQNLQEWAHSQLHNPKKVMYGSTAITTPAEFL NEISRLGASNSSNNDA*

Protein Structures from PDB: proteins of known structure with sequence similarity to SLY1/YDR189W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to SLY1 Homolog Source (per PDB) Protein Alignment: SLY1 vs. Homolog External Links P-Value %Identical %Similar Alignment 1mqs ( Chain: A) Crystal structure of sly1p in complex with an n-terminal peptide of sed5p PDB_Info PDB_Structure Saccharomyces cerevisiae 9.9e-262 100 0 View alignment SCOP MMDB CATH 2pjx ( Chain: A, B) Crystal structure of the munc18c/syntaxin4 n-peptide complex PDB_Info PDB_Structure Mus musculus Chain A = 7.1e-20 23 31 View alignment SCOP MMDB CATH Chain B = 7.1e-20 23 31 View alignment 3c98 ( Chain: A) Revised structure of the munc18a-syntaxin1 complex PDB_Info PDB_Structure Rattus norvegicus 2.4e-18 21 32 View alignment SCOP MMDB CATH 1epu ( Chain: A) X-ray crystal structure of neuronal sec1 from squid PDB_Info PDB_Structure Loligo pealei 4.2e-18 22 31 View alignment SCOP MMDB CATH 1fvh ( Chain: A) Crystal structure analysis of neuronal sec1 from the squid l. pealei PDB_Info PDB_Structure Loligo pealei 4.2e-18 22 31 View alignment SCOP MMDB CATH 1fvf ( Chain: B, A) Crystal structure analysis of neuronal sec1 from the squid l. pealei PDB_Info PDB_Structure Loligo pealei Chain B = 4.2e-18 22 31 View alignment SCOP MMDB CATH Chain A = 4.2e-18 22 31 View alignment 1y9j ( Chain: A) Solution structure of the rat sly1 n-terminal domain PDB_Info PDB_Structure Rattus norvegicus 2.6e-15 38 28 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SLY1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YDR189W	SGD Systematic Sequence
851770	NCBI: Gene ID
NP_010475.1	NCBI: RefSeq protein version ID
NP_010475.1	NCBI: RefSeq protein version ID
6320395	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
58 curated references; 0 references not yet curated
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Boyd A, et al. (2008) A Random Mutagenesis Approach to Isolate Dominant-Negative Yeast sec1 Mutants Reveals a Functional Role for Domain 3a in Yeast and Mammalian Sec1/Munc18 Proteins. Genetics 180(1):165-78	|SEC1 |SNC1 |SNC2
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Non-Fungal Related Genes/Proteins	Graham ME, et al. (2008) A gain-of-function mutant of Munc18-1 stimulates secretory granule recruitment and exocytosis and reveals a direct interaction of Munc18-1 with Rab3. Biochem J 409(2):407-16
Function/Process	Kamena F, et al. (2008) Ypt1p is essential for retrograde Golgi-ER transport and for Golgi maintenance in S. cerevisiae. J Cell Sci 121(Pt 8):1293-302	|ANP1 |ARF1 |BOS1 |EMP47 |KAR2 |MNN1 |SEC22 |SED5 |UFE1 |YPT1 |YPT31 |YPT32
Cellular Location Computational analysis	Qi Y, et al. (2008) Finding friends and enemies in an enemies-only network: A graph diffusion kernel for predicting novel genetic interactions and co-complex membership from yeast genetic interactions. Genome Res 18(12):1991-2004	|AAH1 |ADA2 |AGE1 |AGE2 |AIM29 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |ANP1 |ARL3 |ARP3 |ARP4 |MORE
Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs Techniques and Reagents	Braun S and Jentsch S (2007) SM-protein-controlled ER-associated degradation discriminates between different SNAREs. EMBO Rep 8(12):1176-82	|CDC48 |SED5 |UBC6 |UBC7 |UFD1 |UFE1
Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions	Hu SH, et al. (2007) Structure of the Munc18c/Syntaxin4 N-peptide complex defines universal features of the N-peptide binding mode of Sec1/Munc18 proteins. Proc Natl Acad Sci U S A 104(21):8773-8	|SEC1 |SED5 |VPS33 |VPS45
Fungal Related Genes/Proteins	Hu W, et al. (2007) Essential gene identification and drug target prioritization in Aspergillus fumigatus. PLoS Pathog 3(3):e24	|ALG6 |AUR1 |BRX1 |CDS1 |ERG10 |ERG11 |ERG12 |ESF1 |FKS1 |GCD6 |GFA1 |GUS1 |HEM15 |HIS4 |MORE
Evolution Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Koumandou VL, et al. (2007) Control systems for membrane fusion in the ancestral eukaryote; evolution of tethering complexes and SM proteins. BMC Evol Biol 7():29	|BET3 |BET5 |COG1 |COG2 |COG3 |COG4 |COG5 |COG6 |COG7 |COG8 |DSL1 |EXO70 |EXO84 |GSG1 |MORE
Cross-species Expression Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Li Y, et al. (2007) Mutations of the SM protein Sly1 resulting in bypass of GTPase requirement in vesicular transport are confined to a short helical region. FEBS Lett 581(29):5698-702	|YPT1 |YPT6
Protein Sequence Features	Carpp LN, et al. (2006) The Sec1p/Munc18 protein Vps45p binds its cognate SNARE proteins via two distinct modes. J Cell Biol 173(6):927-36	|SNC2 |TLG2 |VPS45
Mutants/Phenotypes Strains/Constructs	Cooper AA, et al. (2006) Alpha-synuclein blocks ER-Golgi traffic and Rab1 rescues neuron loss in Parkinson's models. Science 313(5785):324-8	|GYP8 |YPT1
Function/Process Techniques and Reagents	Flanagan JJ and Barlowe C (2006) Cysteine-disulfide cross-linking to monitor SNARE complex assembly during endoplasmic reticulum-Golgi transport. J Biol Chem 281(4):2281-8	|BET1 |BOS1 |SEC22 |SED5 |USO1
Function/Process Mutants/Phenotypes Strains/Constructs	Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7	|ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG1 |ERG10 |ERG12 |ERG13 |MORE
Non-Fungal Related Genes/Proteins	Arac D, et al. (2005) Three-dimensional structure of the rSly1 N-terminal domain reveals a conformational change induced by binding to syntaxin 5. J Mol Biol 346(2):589-601	|SEC1
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Ballew N, et al. (2005) A Rab requirement is not bypassed in SLY1-20 suppression. Mol Biol Cell 16(4):1839-49	|BET3 |COG2 |COG3 |ERV41 |SEC22 |SED5 |USO1 |YPT1 |YPT31 |YPT32 |YPT6
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52	|ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Li Y, et al. (2005) Structure-based functional analysis reveals a role for the SM protein Sly1p in retrograde transport to the endoplasmic reticulum. Mol Biol Cell 16(9):3951-62	|BOS1 |DSL1 |SEC20 |SEC22 |TIP20 |UFE1 |USE1
Mutants/Phenotypes Protein-protein Interactions	Peng R and Gallwitz D (2004) Multiple SNARE interactions of an SM protein: Sed5p/Sly1p binding is dispensable for transport. EMBO J 23(20):3939-49	|SED5
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Kosodo Y, et al. (2003) Cooperation of Sly1/SM-family protein and sec18/NSF of Saccharomyces cerevisiae in disassembly of cis-SNARE membrane-protein complexes. Biosci Biotechnol Biochem 67(2):448-50	|SEC18 |SED5
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure	Bracher A and Weissenhorn W (2002) Structural basis for the Golgi membrane recruitment of Sly1p by Sed5p. EMBO J 21(22):6114-24	|SEC1 |SED5 |VPS45
Function/Process	Dulubova I, et al. (2002) How Tlg2p/syntaxin 16 'snares' Vps45. EMBO J 21(14):3620-31	|PEP12 |SED5 |TLG2 |UFE1 |VPS45
Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Kosodo Y, et al. (2002) Binding of Sly1 to Sed5 enhances formation of the yeast early Golgi SNARE complex. J Cell Sci 115(Pt 18):3683-91	|BET1 |SED5
Cellular Location Function/Process Protein-protein Interactions Regulatory Role	Peng R and Gallwitz D (2002) Sly1 protein bound to Golgi syntaxin Sed5p allows assembly and contributes to specificity of SNARE fusion complexes. J Cell Biol 157(4):645-55	|SEC1 |SEC17 |SED5
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Yamaguchi T, et al. (2002) Sly1 binds to Golgi and ER syntaxins via a conserved N-terminal peptide motif. Dev Cell 2(3):295-305	|SED5 |UFE1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Bensen ES, et al. (2001) Ric1p and the Ypt6p GTPase function in a common pathway required for localization of trans-Golgi network membrane proteins. Mol Biol Cell 12(1):13-26	|END3 |GOS1 |KEX2 |PEP1 |RIC1 |SED5 |SYS1 |YKT6 |YPT6
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kosodo Y, et al. (2001) Multicopy suppressors of the sly1 temperature-sensitive mutation in the ER-Golgi vesicular transport in Saccharomyces cerevisiae. Yeast 18(11):1003-14	|BET1 |DGK1 |MID2 |SEC1 |SLG1 |SSB1 |SSB2 |SSD1 |USO1 |WSC2
Function/Process Genetic Interactions Protein-protein Interactions	Reilly BA, et al. (2001) Golgi-to-endoplasmic reticulum (ER) retrograde traffic in yeast requires Dsl1p, a component of the ER target site that interacts with a COPI coat subunit. Mol Biol Cell 12(12):3783-96	|DSL1 |KAR2 |RET2 |SEC20 |TIP20 |UFE1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Vanrheenen SM, et al. (2001) Dsl1p, an essential protein required for membrane traffic at the endoplasmic reticulum/Golgi interface in yeast. Traffic 2(3):212-31	|DSL1 |ERV14 |SEC21
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Cao X and Barlowe C (2000) Asymmetric requirements for a Rab GTPase and SNARE proteins in fusion of COPII vesicles with acceptor membranes. J Cell Biol 149(1):55-66	|BET1 |BOS1 |SEC22 |SED5 |YPT1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Ho JH, et al. (2000) Nascent 60S ribosomal subunits enter the free pool bound by Nmd3p. RNA 6(11):1625-34	|NMD3 |PRT1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Li Y, et al. (2000) Repression of ribosome and tRNA synthesis in secretion-defective cells is signaled by a novel branch of the cell integrity pathway. Mol Cell Biol 20(11):3843-51	|BCK1 |PKC1 |RAP1 |SEC1 |SLG1 |SLT2 |WSC2 |WSC3 |YPT6
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	VanRheenen SM, et al. (1999) Sec34p, a protein required for vesicle tethering to the yeast Golgi apparatus, is in a complex with Sec35p. J Cell Biol 147(4):729-42	|BET1 |COG2 |COG3 |RUD3 |SEC22 |USO1 |YKT6 |YPT1
Function/Process Mutants/Phenotypes	Cao X, et al. (1998) Initial docking of ER-derived vesicles requires Uso1p and Ypt1p but is independent of SNARE proteins. EMBO J 17(8):2156-65	|BET1 |BOS1 |GDI1 |PBI2 |SED5 |TRX1 |TRX2 |USO1 |YPT1
Function/Process Non-Fungal Related Genes/Proteins Protein-protein Interactions	Kosodo Y, et al. (1998) Protein-protein interactions of the yeast Golgi t-SNARE Sed5 protein distinct from its neural plasma membrane cognate syntaxin 1. Biochem Biophys Res Commun 250(2):212-6	|SED5
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Li B and Warner JR (1998) Genetic interaction between YPT6 and YPT1 in Saccharomyces cerevisiae. Yeast 14(10):915-22	|SSD1 |YPT1 |YPT6
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Sacher M, et al. (1998) TRAPP, a highly conserved novel complex on the cis-Golgi that mediates vesicle docking and fusion. EMBO J 17(9):2494-503	|BET1 |BET3 |SED5 |TRS20 |TRS23 |TRS33
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	VanRheenen SM, et al. (1998) Sec35p, a novel peripheral membrane protein, is required for ER to Golgi vesicle docking. J Cell Biol 141(5):1107-19	|BET1 |COG2 |COG3 |SEC22 |USO1 |YKT6 |YPT1
Function/Process Mutants/Phenotypes Protein-protein Interactions	Grabowski R and Gallwitz D (1997) High-affinity binding of the yeast cis-Golgi t-SNARE, Sed5p, to wild-type and mutant Sly1p, a modulator of transport vesicle docking. FEBS Lett 411(2-3):169-72	|SED5 |YPT1
Genetic Interactions Protein-protein Interactions	Lupashin VV and Waters MG (1997) t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Science 276(5316):1255-8	|BET1 |SEC18 |SEC22 |SED5 |YPT1
Reviews	Rothman JE and Sollner TH (1997) Throttles and dampers: controlling the engine of membrane fusion. Science 276(5316):1212-3	|SEC1 |SEC4 |SED5 |YPT1
Non-Fungal Related Genes/Proteins	Dascher C and Balch WE (1996) Mammalian Sly1 regulates syntaxin 5 function in endoplasmic reticulum to Golgi transport. J Biol Chem 271(27):15866-9
Reviews	Halachmi N and Lev Z (1996) The Sec1 family: a novel family of proteins involved in synaptic transmission and general secretion. J Neurochem 66(3):889-97
Genetic Interactions	Kito M, et al. (1996) Calcium and SLY genes suppress the temperature-sensitive secretion defect of Saccharomyces cerevisiae uso1 mutant. Biochem Biophys Res Commun 220(3):653-7	|USO1 |YPT1
Function/Process Mutants/Phenotypes	Lupashin VV, et al. (1996) Biochemical requirements for the targeting and fusion of ER-derived transport vesicles with purified yeast Golgi membranes. J Cell Biol 132(3):277-89	|GDA1 |GDI1 |SEC7 |USO1 |YPT1
Non-Fungal Related Genes/Proteins	Peterson MR, et al. (1996) A mammalian homologue of SLY1, a yeast gene required for transport from endoplasmic reticulum to Golgi. Gene 169(2):293-4
Reviews	Pevsner J (1996) The role of Sec1p-related proteins in vesicle trafficking in the nerve terminal. J Neurosci Res 45(2):89-95	|SEC1 |VPS33 |VPS45
Non-Fungal Related Genes/Proteins	Pevsner J, et al. (1996) Mammalian homologues of yeast vacuolar protein sorting (vps) genes implicated in Golgi-to-lysosome trafficking. Gene 183(1-2):7-14	|SEC1 |VPS33 |VPS45
Mutants/Phenotypes	Sapperstein SK, et al. (1996) Assembly of the ER to Golgi SNARE complex requires Uso1p. J Cell Biol 132(5):755-67	|BET1 |BOS1 |SEC22 |USO1 |YKT6 |YPT1
Fungal Related Genes/Proteins	Yoshida S, et al. (1995) STT10, a novel class-D VPS yeast gene required for osmotic integrity related to the PKC1/STT1 protein kinase pathway. Gene 160(1):117-22	|BCK1 |PKC1 |SEC1 |STT4 |VPS33 |VPS45
Fungal Related Genes/Proteins	Cowles CR, et al. (1994) Mutations in the VPS45 gene, a SEC1 homologue, result in vacuolar protein sorting defects and accumulation of membrane vesicles. J Cell Sci 107 ( Pt 12):3449-59	|SEC1 |VPS33 |VPS45
DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Sequence Features Regulatory Role Strains/Constructs	Mizuta K and Warner JR (1994) Continued functioning of the secretory pathway is essential for ribosome synthesis. Mol Cell Biol 14(4):2493-502	|PRC1 |SEC1 |SEC11 |SEC14 |SEC18 |SEC53 |SEC63 |SEC7
Function/Process Fungal Related Genes/Proteins	Sogaard M, et al. (1994) A rab protein is required for the assembly of SNARE complexes in the docking of transport vesicles. Cell 78(6):937-48	|BET1 |BOS1 |SEC22 |SED5 |YKT6 |YPT1
Non-Fungal Related Genes/Proteins	Salzberg A, et al. (1993) The Drosophila Ras2 and Rop gene pair: a dual homology with a yeast Ras-like gene and a suppressor of its loss-of-function phenotype. Development 117(4):1309-19	|RAS2 |SEC1 |VPS33 |YPT1
Other Features	Aalto MK, et al. (1992) A family of proteins involved in intracellular transport. Cell 68(2):181-2	|SEC1 |VPS33
Reviews	Pryer NK, et al. (1992) Vesicle-mediated protein sorting. Annu Rev Biochem 61:471-516	|ARF1 |ARF2 |BET1 |BET2 |BOS1 |CHC1 |CLC1 |ERD1 |ERD2 |SAR1 |SEC1 |SEC12 |SEC13 |SEC14 |MORE
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Dascher C, et al. (1991) Identification and structure of four yeast genes (SLY) that are able to suppress the functional loss of YPT1, a member of the RAS superfamily. Mol Cell Biol 11(2):872-85	|BET1 |SEC22 |SLY41 |YPT1
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Ossig R, et al. (1991) The yeast SLY gene products, suppressors of defects in the essential GTP-binding Ypt1 protein, may act in endoplasmic reticulum-to-Golgi transport. Mol Cell Biol 11(6):2980-93	|BET1 |SEC21 |SEC22 |SLY41 |YPT1

Return to SGD

Send a Message to the SGD Curators