---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

CDC1/YDR182W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIV: 827580 to 829055 CDS: 827580 - 829055 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
CDC1	YDR182W	DSC1, DSR1, ESP2	ORF, Verified	S000002590
Description
Putative lipid phosphatase of the endoplasmic reticulum; shows Mn2+ dependence and may affect Ca2+ signaling; mutants display actin and general growth defects and pleiotropic defects in cell cycle progression and organelle distribution

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By hydrolase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004843 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2008-02-14 UniProtKB metal ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0479 Assigned on 2008-02-14 UniProtKB molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2001-01-19 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By DNA repair Halbrook J and Hoekstra MF (1994) Mutations in the Saccharomyces cerevisiae CDC1 gene affect double-strand-break-induced intrachromosomal recombination. Mol Cell Biol 14(12):8037-50      IMP : Inferred from Mutant Phenotype Assigned on 2003-09-17 SGD actin cytoskeleton organization Rossanese OW, et al. (2001) A role for actin, Cdc1p, and Myo2p in the inheritance of late Golgi elements in Saccharomyces cerevisiae. J Cell Biol 153(1):47-62        IMP : Inferred from Mutant Phenotype Assigned on 2003-09-17 SGD cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0131 Assigned on 2007-05-23 UniProtKB cell division GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0132 Assigned on 2007-05-23 UniProtKB cellular manganese ion homeostasis Paidhungat M and Garrett S (1998) Cdc1 and the vacuole coordinately regulate Mn2+ homeostasis in the yeast Saccharomyces cerevisiae. Genetics 148(4):1787-98        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction Assigned on 2003-09-17 SGD dephosphorylation Losev E, et al. (2008) Cdc1p is an endoplasmic reticulum-localized putative lipid phosphatase that affects Golgi inheritance and actin polarization by activating Ca2+ signaling. Mol Cell Biol 28(10):3336-43          IMP : Inferred from Mutant Phenotype Assigned on 2008-07-07 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Losev E, et al. (2008) Cdc1p is an endoplasmic reticulum-localized putative lipid phosphatase that affects Golgi inheritance and actin polarization by activating Ca2+ signaling. Mol Cell Biol 28(10):3336-43          IDA : Inferred from Direct Assay Assigned on 2008-07-07 SGD integral to membrane Kim H, et al. (2003) Topology models for 37 Saccharomyces cerevisiae membrane proteins based on C-terminal reporter fusions and predictions. J Biol Chem 278(12):10208-13          ISM : Inferred from Sequence Model Assigned on 2009-08-26 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forCDC1/YDR182W for CDC1 1) Paidhungat M and Garrett S (1998) Cdc1 and the vacuole coordinately regulate Mn2+ homeostasis in the yeast Saccharomyces cerevisiae. Genetics 148(4):1787-98        2) Rossanese OW, et al. (2001) A role for actin, Cdc1p, and Myo2p in the inheritance of late Golgi elements in Saccharomyces cerevisiae. J Cell Biol 153(1):47-62        3) Losev E, et al. (2008) Cdc1p is an endoplasmic reticulum-localized putative lipid phosphatase that affects Golgi inheritance and actin polarization by activating Ca2+ signaling. Mol Cell Biol 28(10):3336-43          4) Hartwell LH, et al. (1970) Genetic control of the cell-division cycle in yeast. I. Detection of mutants. Proc Natl Acad Sci U S A 66(2):352-9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for CDC1/YDR182W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for CDC1/YDR182W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MVYRNRS C-term IYFYTVV Length(aa) 491 MW(Da) 57,147 pI 10.28 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.038   Codon Adaptation Index 0.120   Frequency of Optimal Codons 0.388   Hydropathicity of Protein -0.475   Aromaticity Score 0.130

10 20 30 40 50 | | | | | MVYRNRSKSVLSTHSKKSDDKAHYKSRSKKKSKSRSKKRLRIYWRYISIV WILWLGLISYYESVVVKRAMKKCQWSTWEDWPEGAESHRVGLFADPQIMD EYSYPGRPQIVNYFTRVIVDHYHRRNWKYVQYYLDPDSNFFLGDLFDGGR NWDDKQWIKEYTRFNQIFPKKPLRRTVMSLPGNHDIGFGDTVVESSLQRF SSYFGETSSSLDAGNHTFVLLDTISLSDKTNPNVSRVPRQFLDNFAMGSH PLPRILLTHVPLWRDPEQQTCGQLRESKEPFPIQKGHQYQTVIENDISQE ILTKIQPEILFSGDDHDHCQISHSYPFQGKTKNAQEITVKSCAMNMGISR PAIQLLSLYNPSDLTMVNAGGEYASKTYQTELCYMPDPYKAIRMYLWGLL FSAAFIAYMHFFPKSFNNRVATIMNRVFTRPDGNTSDLPLPTSISKSKSK KSLTHSKYAVNDTRSIKQFLVNAIVLFVSVMPIFIYFYTVV*

Protein Structures from PDB: proteins of known structure with sequence similarity to CDC1/YDR182W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
CDC1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YDR182W	SGD Systematic Sequence
851763	NCBI: Gene ID
NP_010468.1	NCBI: RefSeq protein version ID
NP_010468.1	NCBI: RefSeq protein version ID
6320388	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
30 curated references; 0 references not yet curated
Reviews	Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett	|ARV1 |BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |MORE
Genetic Interactions Strains/Constructs	Waples WG, et al. (2009) Putting the Brake on FEAR: Tof2 Promotes the Biphasic Release of Cdc14 Phosphatase during Mitotic Exit. Mol Biol Cell 20(1):245-55	|CDC14 |CIN8 |CSM1 |DBF2 |FOB1 |KAR3 |LRS4 |MOB1 |RTT103 |TOF2 |YDJ1
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Losev E, et al. (2008) Cdc1p is an endoplasmic reticulum-localized putative lipid phosphatase that affects Golgi inheritance and actin polarization by activating Ca2+ signaling. Mol Cell Biol 28(10):3336-43	|CCH1 |PER1 |SLT2
Protein Processing/Modification/Regulation	Lee MW, et al. (2007) Global protein expression profiling of budding yeast in response to DNA damage. Yeast 24(3):145-54	|ACK1 |ANB1 |AQY2 |ASF1 |ASK1 |ATG16 |ATP7 |BER1 |CBP4 |CDC25 |CWC24 |FET4 |HIR3 |HMG2 |MORE
Non-Fungal Related Genes/Proteins Regulation of	Tu BP and McKnight SL (2007) The yeast metabolic cycle: insights into the life of a eukaryotic cell. Cold Spring Harb Symp Quant Biol 72:339-43	|CTA1 |DBP1 |ERG11 |HSP26 |INO1 |MCH5 |MRS4 |SAD1 |SEC18 |SLM3 |SWI3 |TMA29 |ULA1 |YAH1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Bobula J, et al. (2006) Why molecular chaperones buffer mutational damage: a case study with a yeast Hsp40/70 system. Genetics 174(2):937-44	|ALG2 |ARC18 |GPI2 |NOP4 |RPB2 |RRP1 |RRP15 |SAC1 |SCH9 |SPE3 |TAF10 |TRK1 |VPS27 |ZUO1
Cell Cycle Phase Involved Function/Process Mutants/Phenotypes Strains/Constructs	Yu L, et al. (2006) A survey of essential gene function in the yeast cell division cycle. Mol Biol Cell 17(11):4736-47	|ALA1 |CDC13 |CDC14 |CDC15 |CDC16 |CDC19 |CDC20 |CDC21 |CDC23 |CDC25 |CDC27 |CDC3 |CDC34 |CDC37 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Eguez L, et al. (2004) Yeast Mn2+ transporter, Smf1p, is regulated by ubiquitin-dependent vacuolar protein sorting. Genetics 167(1):107-17	|DID4 |DOA4 |HSE1 |PER1 |SMF1 |SNF7 |SNF8 |SRN2 |STP22 |UBC4 |VPS20 |VPS24 |VPS25 |VPS27 |MORE
Cellular Location Protein Physical Properties	Kim H, et al. (2003) Topology models for 37 Saccharomyces cerevisiae membrane proteins based on C-terminal reporter fusions and predictions. J Biol Chem 278(12):10208-13	|AQY1 |ASG7 |ATO2 |AVT6 |ECM7 |ERP2 |ERV15 |FCY2 |FLD1 |HHY1 |IZH4 |MEP1 |MUP1 |OSW5 |MORE
Non-Fungal Related Genes/Proteins	Pothof J, et al. (2003) Identification of genes that protect the C. elegans genome against mutations by genome-wide RNAi. Genes Dev 17(4):443-8	|CDC14 |CDC53 |CEF1 |CTF18 |CTI6 |DCS2 |GRC3 |GTR1 |HHT1 |HHT2 |HSL7 |HST2 |IRC20 |JAC1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Rossanese OW, et al. (2001) A role for actin, Cdc1p, and Myo2p in the inheritance of late Golgi elements in Saccharomyces cerevisiae. J Cell Biol 153(1):47-62	|ACT1 |MYO2 |RIC1 |SEC7
Function/Process Fungal Related Genes/Proteins Protein Sequence Features	Sone T and Griffiths AJ (1999) The frost gene of Neurospora crassa is a homolog of yeast cdc1 and affects hyphal branching via manganese homeostasis. Fungal Genet Biol 28(3):227-37
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Paidhungat M and Garrett S (1998) Cdc1 and the vacuole coordinately regulate Mn2+ homeostasis in the yeast Saccharomyces cerevisiae. Genetics 148(4):1787-98	|ARF1 |PEP3 |PEP5 |PER1 |VPS16 |VPS4
Function/Process Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Regulatory Role Strains/Constructs	Paidhungat M and Garrett S (1998) Cdc1 is required for growth and Mn2+ regulation in Saccharomyces cerevisiae. Genetics 148(4):1777-86	|SMF1
Genetic Interactions Mutants/Phenotypes	Paidhungat M and Garrett S (1997) A homolog of mammalian, voltage-gated calcium channels mediates yeast pheromone-stimulated Ca2+ uptake and exacerbates the cdc1(Ts) growth defect. Mol Cell Biol 17(11):6339-47	|CCH1 |MID1
Reviews	Supek F, et al. (1997) Function of metal-ion homeostasis in the cell division cycle, mitochondrial protein processing, sensitivity to mycobacterial infection and brain function. J Exp Biol 200(Pt 2):321-30	|COT1 |FET3 |FET4 |MIF1 |PMC1 |PMR1 |SMF1 |SMF2 |SMF3 |VCX1 |ZRC1
Function/Process Genetic Interactions Mutants/Phenotypes	Supek F, et al. (1996) A yeast manganese transporter related to the macrophage protein involved in conferring resistance to mycobacteria. Proc Natl Acad Sci U S A 93(10):5105-10	|MAS1 |SMF1
Mutants/Phenotypes Strains/Constructs	Loukin S and Kung C (1995) Manganese effectively supports yeast cell-cycle progression in place of calcium. J Cell Biol 131(4):1025-37
Cell Cycle Phase Involved Genetic Interactions Mutants/Phenotypes Protein-Nucleic Acid Interactions Strains/Constructs	Morgan BA, et al. (1995) A yeast transcription factor bypassing the requirement for SBF and DSC1/MBF in budding yeast has homology to bacterial signal transduction proteins. EMBO J 14(22):5679-89	|CLN1 |CLN2 |MBP1 |SKN7 |SWI4 |SWI6
Mutants/Phenotypes Strains/Constructs	Halbrook J and Hoekstra MF (1994) Mutations in the Saccharomyces cerevisiae CDC1 gene affect double-strand-break-induced intrachromosomal recombination. Mol Cell Biol 14(12):8037-50	|ADE5,7 |HO |URA3
Alias Mutants/Phenotypes Strains/Constructs	Nelson KK and Lemmon SK (1993) Suppressors of clathrin deficiency: overexpression of ubiquitin rescues lethal strains of clathrin-deficient Saccharomyces cerevisiae. Mol Cell Biol 13(1):521-32	|CHC1 |SCD1 |SCD6 |UBI4
Reviews	Sherlock G and Rosamond J (1993) Starting to cycle: G1 controls regulating cell division in budding yeast. J Gen Microbiol 139(11):2531-41	|CDC28 |CDC4 |CDC7 |CLN1 |CLN2 |CLN3 |DBF4 |SCM4 |SWI4 |SWI6
Alias Function/Process Fungal Related Genes/Proteins Protein-Nucleic Acid Interactions	Lowndes NF, et al. (1992) Control of DNA synthesis genes in fission yeast by the cell-cycle gene cdc10+. Nature 355(6359):449-53
Alias Cell Cycle Phase Involved Regulatory Role	Johnston LH, et al. (1991) A cell-cycle-regulated trans-factor, DSC1, controls expression of DNA synthesis genes in yeast. Cold Spring Harb Symp Quant Biol 56:169-76
Cell Cycle Phase Involved Function/Process Mutants/Phenotypes	Reid BJ and Hartwell LH (1977) Regulation of mating in the cell cycle of Saccharomyces cerevisiae. J Cell Biol 75(2 Pt 1):355-65	|CDC10 |CDC11 |CDC13 |CDC14 |CDC15 |CDC16 |CDC21 |CDC24 |CDC28 |CDC3 |CDC33 |CDC4 |CDC6 |CDC7 |MORE
Cell Cycle Phase Involved Function/Process Mutants/Phenotypes Strains/Constructs	Simchen G (1974) Are mitotic functions required in meiosis? Genetics 76(4):745-53	|CDC10 |CDC11 |CDC13 |CDC14 |CDC15 |CDC16 |CDC20 |CDC23 |CDC24 |CDC28 |CDC3 |CDC4 |CDC5 |CDC6 |MORE
Mutants/Phenotypes Strains/Constructs	Bucking-Throm E, et al. (1973) Reversible arrest of haploid yeast cells in the initiation of DNA synthesis by a diffusible sex factor. Exp Cell Res 76(1):99-110	|CDC11 |CDC13 |CDC14 |CDC15 |CDC3 |CDC4 |CDC5 |CDC6 |CDC7 |CDC8 |CDC9 |POL3
Cell Cycle Phase Involved Function/Process Genetic Interactions Mapping Mutants/Phenotypes Strains/Constructs	Hartwell LH, et al. (1973) Genetic Control of the Cell Division Cycle in Yeast: V. Genetic Analysis of cdc Mutants. Genetics 74(2):267-286	|CDC10 |CDC11 |CDC12 |CDC13 |CDC14 |CDC15 |CDC16 |CDC19 |CDC20 |CDC21 |CDC22 |CDC23 |CDC24 |CDC25 |MORE
Cell Cycle Phase Involved Mutants/Phenotypes Strains/Constructs	Hartwell LH, et al. (1970) Genetic control of the cell-division cycle in yeast. I. Detection of mutants. Proc Natl Acad Sci U S A 66(2):352-9	|CDC3 |POL3

Return to SGD

Send a Message to the SGD Curators