---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SAC3/YDR159W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIV: 771875 to 775780 CDS: 771875 - 775780 Genetic position: 92 cM Genetic Map Data Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SAC3	YDR159W	LEP1	ORF, Verified	S000002566
Description
Nuclear pore-associated protein, forms a complex with Thp1p that is involved in transcription and in mRNA export from the nucleus

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By protein binding Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52          IPI : Inferred from Physical Interaction with SGD:SUB2, SGD:THP1, SGD:NUP1, SGD:MEX67 Assigned on 2003-06-05 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By actin filament-based process Novick P, et al. (1989) Suppressors of yeast actin mutations. Genetics 121(4):659-74        IGI : Inferred from Genetic Interaction with SGD:ACT1 Assigned on 2008-07-02 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA 3'-end processing Saguez C, et al. (2008) Nuclear mRNA surveillance in THO/sub2 mutants is triggered by inefficient polyadenylation. Mol Cell 31(1):91-103          IMP : Inferred from Mutant Phenotype Assigned on 2008-08-21 SGD mRNA export from nucleus Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52          IMP : Inferred from Mutant Phenotype Assigned on 2009-01-23 SGD Lei EP, et al. (2003) Sac3 is an mRNA export factor that localizes to cytoplasmic fibrils of nuclear pore complex. Mol Biol Cell 14(3):836-47        IPI : Inferred from Physical Interaction with SGD:MTR2, SGD:MEX67, SGD:DBP5, SGD:NUP116, SGD:NSP1 IGI : Inferred from Genetic Interaction with SGD:MTR2, SGD:MEX67 IMP : Inferred from Mutant Phenotype Assigned on 2003-07-09 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mitosis Bauer A and Kolling R (1996) The SAC3 gene encodes a nuclear protein required for normal progression of mitosis. J Cell Sci 109 ( Pt 6):1575-83        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD nuclear import Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc protein export from nucleus Jones AL, et al. (2000) SAC3 may link nuclear protein export to cell cycle progression. Proc Natl Acad Sci U S A 97(7):3224-9        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction Assigned on 2002-12-11 SGD protein import Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc protein import into nucleus Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc protein localization in nucleus Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc protein localization in organelle Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc regulation of transcription GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0805 Assigned on 2009-07-22 UniProtKB ribosomal subunit export from nucleus Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transcription GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0804 Assigned on 2007-05-23 UniProtKB transcription-coupled nucleotide-excision repair Gaillard H, et al. (2007) A new connection of mRNP biogenesis and export with transcription-coupled repair. Nucleic Acids Res 35(12):3893-906        IMP : Inferred from Mutant Phenotype Assigned on 2007-07-06 SGD transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By nuclear envelope GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0178 Assigned on 2008-02-13 UniProtKB nuclear pore Lei EP, et al. (2003) Sac3 is an mRNA export factor that localizes to cytoplasmic fibrils of nuclear pore complex. Mol Biol Cell 14(3):836-47        IDA : Inferred from Direct Assay Assigned on 2003-12-15 SGD nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2007-05-23 UniProtKB transcription export complex 2 Fischer T, et al. (2004) Yeast centrin Cdc31 is linked to the nuclear mRNA export machinery. Nat Cell Biol 6(9):840-8        IDA : Inferred from Direct Assay Assigned on 2009-04-16 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forSAC3/YDR159W for SAC3 1) Novick P, et al. (1989) Suppressors of yeast actin mutations. Genetics 121(4):659-74        2) Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52          3) Lei EP, et al. (2003) Sac3 is an mRNA export factor that localizes to cytoplasmic fibrils of nuclear pore complex. Mol Biol Cell 14(3):836-47        4) Gallardo M, et al. (2003) Nab2p and the Thp1p-Sac3p complex functionally interact at the interface between transcription and mRNA metabolism. J Biol Chem 278(26):24225-32        5) Novick, P., et al. (1989) Personal Communication, Mortimer Map Edition 10

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SAC3/YDR159W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SAC3/YDR159W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MNTSFGS C-term KKKVNND Length(aa) 1,301 MW(Da) 149,567 pI 9.54 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.031   Codon Adaptation Index 0.141   Frequency of Optimal Codons 0.432   Hydropathicity of Protein -0.654   Aromaticity Score 0.082

10 20 30 40 50 | | | | | MNTSFGSVVPSTNFNFFKGHGNNDNTSANSTVNNSNFFLNSNETKPSKNV FMVHSTSQKKSQQPLQNLSHSPSYTENKPDKKKKYMINDAKTIQLVGPLI SSPDNLGFQKRSHKARELPRFLINQEPQLEKRAFVQDPWDKANQEKMISL EESIDDLNELYETLKKMRNTERSIMEEKGLVDKADSAKDLYDAIVFQGTC LDMCPTFERSRRNVEYTVYSYEKNQPNDKKASRTKALKVFARPAAAAAPP LPSDVRPPHILVKTLDYIVDNLLTTLPESEGFLWDRMRSIRQDFTYQNYS GPEAVDCNERIVRIHLLILHIMVKSNVEFSLQQELEQLHKSLITLSEIYD DVRSSGGTCPNEAEFRAYALLSKIRDPQYDENIQRLPKHIFQDKLVQMAL CFRRVISNSAYTERGFVKTENCLNFYARFFQLMQSPSLPLLMGFFLQMHL TDIRFYALRALSHTLNKKHKPIPFIYLENMLLFNNRQEIIEFCNYYSIEI INGDAADLKTLQHYSHKLSETQPLKKTYLTCLERRLQKTTYKGLINGGED NLASSVYVKDPKKDRIPSIADQSFLMENFQNNYNEKLNQNSSVKPQINTS PKRVATRPNHFPFSQESKQLPQISQSHTLSTNPLLTPQVHGDLSEQKQQQ IKTVTDGGSPFVFDQSAQNSTVEASKAHMISTTSNGAYDEKLSSEQEEMR KKEEQRIEEEKTQLKKKQENADKQVITEQIANDLVKEVVNSSVISIVKRE FSEANYRKDFIDTMTRELYDAFLHERLYLIYMDSRAELKRNSTLKKKFFE KWQASYSQAKKNRILEEKKREEIKLVSHQLGVPGFKKSTCLFRTPYKGNV NSSFMLSSSDKNLIFSPVNDEFNKFATHLTKISKLWRPLEMQSIYYDNLT KKFPSNSLTPANLFIYAKDWTSLSNRWILSKFNLQTAQDSKKFSNNIISS RIICIDDEYEPSDFSDLQLLIFNTGVTNPDIFDLEMKLKDDGEELIKLIT GISLNTNICFSLLIIYWESAENTLSESTIKHLLKLNRISKNYSSVIERID LMNLTEESPHKCLEDKLSEISHSYVYKLTERGKYDKTLRQKRSLAGIHSR STQLQTTKDIDQKMKKMLEKEKNKYQQQIGERNTYAHLESHIDASPRSKK RKLPILLSTSHSSQFKTPLASRLNTSGSSTSPPLPSHLAMKFRKNSRVTS LHTVLPVSTPSHSNNIPAASFSGNNTTDIQSQQLIENQKSTSVYLNNVSE RILGNQEICQTPINPVTPVLDGADQGKEDIPDSILELKILIDSVKKKVNN D*

Protein Structures from PDB: proteins of known structure with sequence similarity to SAC3/YDR159W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to SAC3 Homolog Source (per PDB) Protein Alignment: SAC3 vs. Homolog External Links P-Value %Identical %Similar Alignment 3fwc ( Chain: J, N, B, F) Sac3:sus1:cdc31 complex PDB_Info PDB_Structure Saccharomyces cerevisiae Chain J = 2.1e-26 100 0 View alignment SCOP MMDB CATH Chain N = 2.1e-26 100 0 View alignment Chain B = 2.1e-26 100 0 View alignment Chain F = 2.1e-26 100 0 View alignment 3fwb ( Chain: B) Sac3:sus1:cdc31 complex PDB_Info PDB_Structure Saccharomyces cerevisiae 7.6e-16 100 0 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SAC3	Novick, P., et al. (1989) Personal Communication, Mortimer Map Edition 10

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YDR159W	SGD Systematic Sequence
851737	NCBI: Gene ID
NP_010443.1	NCBI: RefSeq protein version ID
NP_010443.1	NCBI: RefSeq protein version ID
6320363	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
53 curated references; 0 references not yet curated
Function/Process Mutants/Phenotypes Strains/Constructs	Ahmed S, et al. (2010) DNA zip codes control an ancient mechanism for gene targeting to the nuclear periphery. Nat Cell Biol 12(2):111-8	|GLE2 |INO1 |MLP2 |NUP1 |NUP157 |NUP2 |NUP60 |SUS1 |THP1 |TSA2
Protein-protein Interactions Strains/Constructs	Ellisdon AM, et al. (2010) Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1. J Biol Chem 285(6):3850-6	|CDC31 |SGF11 |SUS1
Non-Fungal Related Genes/Proteins	Lu Q, et al. (2010) Arabidopsis homolog of the yeast TREX-2 mRNA export complex: components and anchoring nucleoporin. Plant J 61(2):259-70	|CDC31 |NUP1 |SEM1 |SUS1 |THP1
Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Faza MB, et al. (2009) Sem1 is a functional component of the nuclear pore complex-associated messenger RNA export machinery. J Cell Biol 184(6):833-46	|CSN12 |MEX67 |MTR2 |SEM1 |SUB2 |SUS1 |THP1 |YPR045C |YRA1
Cross-species Expression Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs Techniques and Reagents	Govindan M, et al. (2009) Identification of CCR4 and other essential thyroid hormone receptor co-activators by modified yeast synthetic genetic array analysis. Proc Natl Acad Sci U S A 106(47):19854-9	|CCR4 |LGE1 |SHP1 |SRB2 |SWD3 |SWI4 |YJL175W
Cellular Location Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Jani D, et al. (2009) Sus1, Cdc31, and the Sac3 CID region form a conserved interaction platform that promotes nuclear pore association and mRNA export. Mol Cell 33(6):727-37	|CDC31 |MEX67 |NUP133 |SUS1 |THP1 |YRA1
Cellular Location Protein-protein Interactions Regulation of	Klockner C, et al. (2009) Mutational Uncoupling of the Role of Sus1 in Nuclear Pore Complex Targeting of an mRNA Export Complex and Histone H2B Deubiquitination. J Biol Chem 284(18):12049-56	|CDC31 |HTB1 |HTB2 |NGG1 |SGF11 |SGF73 |SPT7 |SUS1 |THP1 |TRA1 |UBP8 |YRA1
RNA Levels and Processing Regulation of	Molin C, et al. (2009) mRNA stability changes precede changes in steady-state mRNA amounts during hyperosmotic stress. RNA 15(4):600-14	|AGP2 |AHP1 |ALD3 |ARP8 |BMH1 |COS8 |DAK1 |DOA1 |EAF3 |ENA1 |GLC7 |GLK1 |GLO1 |GPD1 |MORE
Non-Fungal Related Genes/Proteins	Ohta K, et al. (2009) Decreased expression of germinal center-associated nuclear protein is involved in chromosomal instability in malignant gliomas. Cancer Sci 100(11):2069-76
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Skruzny M, et al. (2009) An endoribonuclease functionally linked to perinuclear mRNP quality control associates with the nuclear pore complexes. PLoS Biol 7(1):e8	|ESC1 |HPR1 |MFT1 |MLP1 |NPL3 |NUP133 |NUP60 |SSA1 |SUB2 |SUS1 |SWT1 |THO2 |THP1 |THP2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Zou J, et al. (2009) Regulation of cell polarity through phosphorylation of Bni4 by Pho85 G1 cyclin-dependent kinases in Saccharomyces cerevisiae. Mol Biol Cell 20(14):3239-50	|AIM44 |APL3 |AXL1 |BCK1 |BEM1 |BEM2 |BNI1 |BNI4 |BNR1 |BOI1 |BOP3 |BUD22 |BUD3 |BUD4 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Amaro IA, et al. (2008) The Saccharomyces cerevisiae Homolog of p24 Is Essential for Maintaining the Association of p150Glued With the Dynactin Complex. Genetics 178(2):703-9	|AIM4 |APQ12 |ARP1 |ARP10 |ASE1 |BIK1 |BIM1 |BNI1 |BUB1 |BUB3 |CHL4 |CIN1 |CIN2 |CTF18 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gonzalez-Aguilera C, et al. (2008) The THP1-SAC3-SUS1-CDC31 complex works in transcription elongation-mRNA export preventing RNA-mediated genome instability. Mol Biol Cell 19(10):4310-8	|DBP5 |GLE1 |HPR1 |MEX67 |MTR4 |NAB2 |NUP120 |NUP133 |NUP60 |NUP84 |PAP1 |RAT1 |RRP6 |SUB2 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Grund SE, et al. (2008) The inner nuclear membrane protein Src1 associates with subtelomeric genes and alters their regulated gene expression. J Cell Biol 182(5):897-910	|CDC31 |HPR1 |MFT1 |PHO11 |PHO12 |PHO84 |SRC1 |SUB2 |SUS1 |THO2 |THP1 |THP2
Cellular Location Protein-protein Interactions	Kohler A, et al. (2008) Yeast Ataxin-7 links histone deubiquitination with gene gating and mRNA export. Nat Cell Biol 10(6):707-15	|ADA2 |CDC31 |GAL1 |HTB1 |HTB2 |SGF11 |SGF73 |SUS1 |THP1 |UBP8
Mutants/Phenotypes Strains/Constructs	Pascual-Garcia P, et al. (2008) Sus1 is recruited to coding regions and functions during transcription elongation in association with SAGA and TREX2. Genes Dev 22(20):2811-22	|ARG1 |GCN4 |GCN5 |MEX67 |RPB11 |RPB3 |RPB4 |RPB7 |RPB9 |RPO21 |SGF11 |SGF73 |SUS1 |TAF6 |MORE
Reviews	Rougemaille M, et al. (2008) mRNA journey to the cytoplasm: attire required. Biol Cell 100(6):327-42	|CBC2 |CDC33 |HRB1 |MEX67 |MTR2 |NAB2 |NPL3 |PAB1 |STO1 |SUB2 |THP1 |YRA1
Mutants/Phenotypes Strains/Constructs	Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67	|AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Saguez C, et al. (2008) Nuclear mRNA surveillance in THO/sub2 mutants is triggered by inefficient polyadenylation. Mol Cell 31(1):91-103	|CDC73 |CTK1 |CTK2 |CTK3 |ELP3 |ELP4 |ELP6 |FCP1 |FIP1 |HPR1 |IKI1 |IKI3 |IOC3 |ISW1 |MORE
Mutants/Phenotypes	Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90	|ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE
Mutants/Phenotypes	Thomsen R, et al. (2008) General, rapid, and transcription-dependent fragmentation of nucleolar antigens in S. cerevisiae mRNA export mutants. RNA 14(4):706-16	|ASM4 |HPR1 |HSP104 |MEX67 |MFT1 |NOP1 |NOP58 |NSR1 |NUP100 |NUP120 |NUP133 |NUP159 |NUP188 |NUP2 |MORE
Function/Process	Ulitsky I, et al. (2008) From E-MAPs to module maps: dissecting quantitative genetic interactions using physical interactions. Mol Syst Biol 4:209	|BRE5 |CIK1 |GBP2 |KAR3 |RPN10 |SEM1 |THP1 |UBP3 |UMP1 |VIK1 |YDL176W |YKL023W |YTA7
Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Wilmes GM, et al. (2008) A genetic interaction map of RNA-processing factors reveals links between Sem1/Dss1-containing complexes and mRNA export and splicing. Mol Cell 32(5):735-46	|APQ12 |BRR1 |CAK1 |CBC2 |CHD1 |CSN12 |CSN9 |DBP5 |GIM4 |IST3 |ISY1 |LRP1 |MEX67 |MUD2 |MORE
Reviews	Ahmed S and Brickner JH (2007) Regulation and epigenetic control of transcription at the nuclear periphery. Trends Genet 23(8):396-402	|ADA2 |CHD1 |GCN5 |HFI1 |HTZ1 |MEX67 |MLP1 |MLP2 |NGG1 |NUP2 |NUP60 |NUP84 |SGF11 |SGF29 |MORE
Protein Sequence Features	Chang EJ, et al. (2007) Prediction of cyclin-dependent kinase phosphorylation substrates. PLoS One 2(7):e656	|ACC1 |ACE2 |ACM1 |ADY3 |AFI1 |ALY2 |ASE1 |ASH1 |BCK1 |BEM3 |BNI1 |BNI4 |BOI1 |BUD3 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaillard H, et al. (2007) A new connection of mRNP biogenesis and export with transcription-coupled repair. Nucleic Acids Res 35(12):3893-906	|DEF1 |FMP27 |HPR1 |MEX67 |MFT1 |MTR2 |RAD26 |RAD7 |RPB10 |RPB11 |RPB2 |RPB3 |RPB4 |RPB5 |MORE
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |MORE
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
DNA/RNA Sequence Features Protein/Nucleic Acid Structure	Singh BN and Hampsey M (2007) A transcription-independent role for TFIIB in gene looping. Mol Cell 27(5):806-16	|BLM10 |GAL10 |HEM3 |PMA1 |RPO21 |SEN1 |SSU72 |SUA7
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Non-Fungal Related Genes/Proteins	Yoshida M, et al. (2007) GANP suppresses DNA recombination, measured by direct-repeat beta-galactosidase gene construct, but does not suppress the type of recombination applying to immunoglobulin genes in mammalian cells. Genes Cells 12(10):1205-13	|SCEI
Function/Process Mutants/Phenotypes Regulatory Role Strains/Constructs	Cabal GG, et al. (2006) SAGA interacting factors confine sub-diffusion of transcribed genes to the nuclear envelope. Nature 441(7094):770-3	|ADA2 |GAL1 |GAL10 |GAL7 |NUP1 |SUS1
Function/Process Mutants/Phenotypes Strains/Constructs	Drubin DA, et al. (2006) Motion as a phenotype: the use of live-cell imaging and machine visual screening to characterize transcription-dependent chromosome dynamics. BMC Cell Biol 7():19	|GAL10 |GAL7
Protein-protein Interactions	Kohler A, et al. (2006) The mRNA export factor Sus1 is involved in Spt/Ada/Gcn5 acetyltransferase-mediated H2B deubiquitinylation through its interaction with Ubp8 and Sgf11. Mol Biol Cell 17(10):4228-36	|ADA2 |CDC31 |HHF1 |HHF2 |HHT1 |HHT2 |HTB1 |HTB2 |SGF11 |SPT20 |SPT7 |SUS1 |TAF12 |TAF6 |MORE
Genetic Interactions	Tabuchi M, et al. (2006) The phosphatidylinositol 4,5-biphosphate and TORC2 binding proteins Slm1 and Slm2 function in sphingolipid regulation. Mol Cell Biol 26(15):5861-75	|AUR1 |BCK1 |CMP2 |CNB1 |CSG2 |FEN1 |GAS1 |GIM3 |INO2 |INO4 |ISC1 |KRE1 |LDB16 |MSS4 |MORE
Genetic Interactions Mutants/Phenotypes	Ingvarsdottir K, et al. (2005) H2B ubiquitin protease Ubp8 and Sgf11 constitute a discrete functional module within the Saccharomyces cerevisiae SAGA complex. Mol Cell Biol 25(3):1162-72	|ADA2 |ARP6 |BRE1 |BRE2 |CDC73 |CTR9 |ELP3 |ELP4 |ELP6 |GCN5 |HOS2 |HTZ1 |NGG1 |PAF1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Keogh MC, et al. (2005) Cotranscriptional set2 methylation of histone H3 lysine 36 recruits a repressive Rpd3 complex. Cell 123(4):593-605	|ARP6 |ASF1 |CDC73 |CHD1 |CTI6 |DEP1 |DOA1 |EAF3 |ELP3 |ELP4 |ELP6 |HOS2 |HTZ1 |ISW1 |MORE
Protein Physical Properties Protein-protein Interactions	Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51	|GLE2 |KAP123 |MEX67 |MLP1 |NIC96 |NSP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP49 |MORE
Genetic Interactions	Milgrom E, et al. (2005) TFIID and Spt-Ada-Gcn5-acetyltransferase functions probed by genome-wide synthetic genetic array analysis using a Saccharomyces cerevisiae taf9-ts allele. Genetics 171(3):959-73	|ADA2 |AIM4 |ARP6 |ASF1 |BCK1 |BDF1 |BEM1 |BEM4 |BUB1 |CDC7 |CDC73 |CLA4 |CTK1 |CTK2 |MORE
Cell Cycle Phase Involved Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Fischer T, et al. (2004) Yeast centrin Cdc31 is linked to the nuclear mRNA export machinery. Nat Cell Biol 6(9):840-8	|CDC31 |SUS1 |THP1
Function/Process Protein-protein Interactions	Rodriguez-Navarro S, et al. (2004) Sus1, a functional component of the SAGA histone acetylase complex and the nuclear pore-associated mRNA export machinery. Cell 116(1):75-86	|SUS1 |THP1 |YRA1
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Regulatory Role Strains/Constructs	Gallardo M, et al. (2003) Nab2p and the Thp1p-Sac3p complex functionally interact at the interface between transcription and mRNA metabolism. J Biol Chem 278(26):24225-32	|NAB2 |THP1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Lei EP, et al. (2003) Sac3 is an mRNA export factor that localizes to cytoplasmic fibrils of nuclear pore complex. Mol Biol Cell 14(3):836-47	|MEX67 |MTR2
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52	|MEX67 |MTR2 |NUP1 |SUB2 |THP1 |YRA1
Mutants/Phenotypes	Stevenson LF, et al. (2001) A large-scale overexpression screen in Saccharomyces cerevisiae identifies previously uncharacterized cell cycle genes. Proc Natl Acad Sci U S A 98(7):3946-51	|ABF1 |ACS2 |ACT1 |ALO1 |ARF1 |ARF2 |BFA1 |BIM1 |BNI4 |CAJ1 |CCC1 |CDC14 |CDC20 |CDC55 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Jones AL, et al. (2000) SAC3 may link nuclear protein export to cell cycle progression. Proc Natl Acad Sci U S A 97(7):3224-9	|CRM1 |NSP1 |SDS23 |SDS24 |YRB2
DNA/RNA Sequence Features	Sengupta DJ, et al. (1999) Identification of RNAs that bind to a specific protein using the yeast three-hybrid system. RNA 5(4):596-601	|NOC2 |SNF5 |SNP1 |SNR19 |YEL057C
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Stella CA, et al. (1999) The Saccharomyces cerevisiae LEP1/SAC3 gene is associated with leucine transport. Mol Gen Genet 262(2):332-41	|ACT1 |GAP1 |LEU4
Reviews	Winsor B and Schiebel E (1997) Review: an overview of the Saccharomyces cerevisiae microtubule and microfilament cytoskeleton. Yeast 13(5):399-434	|ASE1 |BBP1 |BIK1 |BIM1 |CAP1 |CAP2 |CBC2 |CDC31 |CEN3 |CEN5 |CNM67 |DSK2 |DYN1 |DYN2 |MORE
Cellular Location DNA/RNA Sequence Features Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Bauer A and Kolling R (1996) Characterization of the SAC3 gene of Saccharomyces cerevisiae. Yeast 12(10):965-75	|ACT1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Bauer A and Kolling R (1996) The SAC3 gene encodes a nuclear protein required for normal progression of mitosis. J Cell Sci 109 ( Pt 6):1575-83	|ACT1 |NOP1
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Novick P, et al. (1989) Suppressors of yeast actin mutations. Genetics 121(4):659-74	|ACT1 |SAC1 |VPS52

Return to SGD

Send a Message to the SGD Curators