GLE1/YDL207W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIV: 88249 to 89865
CDS: 88249 - 89865

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

GLE1 YDL207W RSS1, BRR3 ORF, Verified S000002366

Description
Cytoplasmic nucleoporin required for polyadenylated RNA export but not for protein import; component of Nup82p nuclear pore subcomplex; contains a nuclear export signal

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
enzyme activator activity Weirich CS, et al. (2006) Activation of the DExD/H-box protein Dbp5 by the nuclear-pore protein Gle1 and its coactivator InsP6 is required for mRNA export. Nat Cell Biol 8(7):668-76
         IDA : Inferred from Direct Assay
IMP : Inferred from Mutant Phenotype
IGI : Inferred from Genetic Interaction with SGD:DBP5
Assigned on 2009-01-23 SGD
inositol hexakisphosphate binding Alcazar-Roman AR, et al. (2006) Inositol hexakisphosphate and Gle1 activate the DEAD-box protein Dbp5 for nuclear mRNA export. Nat Cell Biol 8(7):711-6
       IDA : Inferred from Direct Assay
Assigned on 2007-12-19 SGD
translation initiation factor binding Bolger TA, et al. (2008) The mRNA export factor Gle1 and inositol hexakisphosphate regulate distinct stages of translation. Cell 134(4):624-33
       IPI : Inferred from Physical Interaction with SGD:PRT1, SGD:TIF35
Assigned on 2009-01-07 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
mRNA processing GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0507
Assigned on 2007-05-23 UniProtKB
mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0509
Assigned on 2007-05-23 UniProtKB
poly(A)+ mRNA export from nucleus Del Priore V, et al. (1996) The product of the Saccharomyces cerevisiae RSS1 gene, identified as a high-copy suppressor of the rat7-1 temperature-sensitive allele of the RAT7/NUP159 nucleoporin, is required for efficient mRNA export. Mol Biol Cell 7(10):1601-21
     IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-30 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR012476
Assigned on 2007-05-23 UniProtKB
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
translational initiation Bolger TA, et al. (2008) The mRNA export factor Gle1 and inositol hexakisphosphate regulate distinct stages of translation. Cell 134(4):624-33
       IMP : Inferred from Mutant Phenotype
Assigned on 2009-01-07 SGD
translational termination Bolger TA, et al. (2008) The mRNA export factor Gle1 and inositol hexakisphosphate regulate distinct stages of translation. Cell 134(4):624-33
       IMP : Inferred from Mutant Phenotype
IGI : Inferred from Genetic Interaction with SGD:SUP45
Assigned on 2009-01-07 SGD
transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0811
Assigned on 2009-10-01 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2008-06-16 UniProtKB
mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
         IDA : Inferred from Direct Assay
Assigned on 2004-09-28 SGD
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
           IDA : Inferred from Direct Assay
Assigned on 2006-12-12 SGD
nuclear pore Miller AL, et al. (2004) Cytoplasmic inositol hexakisphosphate production is sufficient for mediating the Gle1-mRNA export pathway. J Biol Chem 279(49):51022-32
       IDA : Inferred from Direct Assay
Assigned on 2004-12-15 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR012476
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0906
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0185
Assigned on 2009-05-06 UniProtKB
nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0539
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forGLE1/YDL207W for GLE1
1) Murphy R and Wente SR (1996) An RNA-export mediator with an essential nuclear export signal. Nature 383(6598):357-60

2) Del Priore V, et al. (1996) The product of the Saccharomyces cerevisiae RSS1 gene, identified as a high-copy suppressor of the rat7-1 temperature-sensitive allele of the RAT7/NUP159 nucleoporin, is required for efficient mRNA export. Mol Biol Cell 7(10):1601-21

3) Hurwitz ME, et al. (1998) Two yeast nuclear pore complex proteins involved in mRNA export form a cytoplasmically oriented subcomplex. Proc Natl Acad Sci U S A 95(19):11241-5

4) Murphy R, et al. (1996) GLE2, a Saccharomyces cerevisiae homologue of the Schizosaccharomyces pombe export factor RAE1, is required for nuclear pore complex structure and function. Mol Biol Cell 7(12):1921-37

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GLE1/YDL207W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GLE1/YDL207W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MRFVFDE

C-term SFPEMSP

Length(aa) 538

MW(Da) 62,073

pI 9.58

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.032

Codon Adaptation Index 0.113

Frequency of Optimal Codons 0.388

Hydropathicity of Protein -0.633

Aromaticity Score 0.065

10 20 30 40 50 | | | | | MRFVFDEVFNSDTDSPEFEETCSTTSSTSSQCPTPEPSPAIKLPSFTKVG TKKLVNESVVILDPALENALRDLNLQSKLIPINEPIVAASSIIVPHSTNM PLPRASHSSLLDNAKNSNATAPLLEAIEESFQRKMQNLVLANQKEIQSIR ENKRRVEEQRKRKEEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEA KLAQQKQEEERKKIEEQNEKERQLKKEHEAKLLQQKDKLGKAVTNFDKIS KMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSN QQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESA LPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGW KRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALS WHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIG EELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP*

Protein Structures from PDB: proteins of known structure with sequence similarity to GLE1/YDL207W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to GLE1 Homolog Source (per PDB) Protein Alignment: GLE1 vs. Homolog External Links
P-Value %Identical %Similar Alignment
1i84 ( Chain: S, V)
Cryo-em structure of the heavy meromyosin subfragment of chicken gizzard smooth muscle myosin with regulatory light chain in the dephosphorylated state. only c alphas provided for regulatory light chain. only backbone atoms provided for s2 fragment.
PDB_Info
PDB_Structure
Gallus gallus Chain S = 0.000360 24 34 View alignment SCOP
MMDB
CATH
Chain V = 0.000360 24 34 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
GLE1 Murphy R and Wente SR (1996) An RNA-export mediator with an essential nuclear export signal. Nature 383(6598):357-60

Murphy R, et al. (1996) GLE2, a Saccharomyces cerevisiae homologue of the Schizosaccharomyces pombe export factor RAE1, is required for nuclear pore complex structure and function. Mol Biol Cell 7(12):1921-37

Alias Name(s) Reference
RSS1 Del Priore V, et al. (1996) The product of the Saccharomyces cerevisiae RSS1 gene, identified as a high-copy suppressor of the rat7-1 temperature-sensitive allele of the RAT7/NUP159 nucleoporin, is required for efficient mRNA export. Mol Biol Cell 7(10):1601-21

BRR3 Noble SM and Guthrie C (1996) Identification of novel genes required for yeast pre-mRNA splicing by means of cold-sensitive mutations. Genetics 143(1):67-80

Nomenclature History Notes
Date Note
2001-10-02 The alias RSS1 has been used to refer to both GLE1/YDL207W and BRR2/YER172C.

Standard Name	Reference
GLE1	Murphy R and Wente SR (1996) An RNA-export mediator with an essential nuclear export signal. Nature 383(6598):357-60 *Murphy R, et al.* (1996)** GLE2, a Saccharomyces cerevisiae homologue of the Schizosaccharomyces pombe export factor RAE1, is required for nuclear pore complex structure and function. Mol Biol Cell 7(12):1921-37

Alias Name(s)	Reference
RSS1	*Del Priore V, et al.* (1996)** The product of the Saccharomyces cerevisiae RSS1 gene, identified as a high-copy suppressor of the rat7-1 temperature-sensitive allele of the RAT7/NUP159 nucleoporin, is required for efficient mRNA export. Mol Biol Cell 7(10):1601-21
BRR3	Noble SM and Guthrie C (1996) Identification of novel genes required for yeast pre-mRNA splicing by means of cold-sensitive mutations. Genetics 143(1):67-80

Date	Note
2001-10-02	The alias RSS1 has been used to refer to both GLE1/YDL207W and BRR2/YER172C.

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YDL207W SGD Systematic Sequence

851320 NCBI: Gene ID

NP_010074.1 NCBI: RefSeq protein version ID

NP_010074.1 NCBI: RefSeq protein version ID

6319994 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YDL207W	SGD Systematic Sequence
851320	NCBI: Gene ID
NP_010074.1	NCBI: RefSeq protein version ID
NP_010074.1	NCBI: RefSeq protein version ID
6319994	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
63 curated references; 0 references not yet curated
Protein-protein Interactions
Regulatory Role
Dossani ZY, et al. (2009) Structure of the C-terminus of the mRNA export factor Dbp5 reveals the interaction surface for the ATPase activator Gle1. Proc Natl Acad Sci U S A 106(38):16251-6
       |DBP5 |IPK1
Reviews
Goldfarb DS (2009) How to grow a bud: an importin acts in asymmetric division. Nat Cell Biol 11(3):243-5
       |DBP5 |KAP104 |MEX67 |NAB2
Cellular Location
Regulation of
Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73
       |APQ12 |ASM4 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP100 |NUP133 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Regulatory Role
Strains/Constructs
Bolger TA, et al. (2008) The mRNA export factor Gle1 and inositol hexakisphosphate regulate distinct stages of translation. Cell 134(4):624-33
       |ARG82 |DBP5 |IPK1 |NAB2 |NIP1 |NUP116 |NUP159 |PRT1 |SUP35 |SUP45 |TIF35
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Reviews
Feldbrugge M, et al. (2008) The posttranscriptional machinery of Ustilago maydis. Fungal Genet Biol 45 Suppl 1:S40-6
       |ACT1 |ASH1 |DBP5 |KEM1 |MEX67 |MTR2 |MYO4 |NAM7 |NIP1 |NMD2 |NOP58 |PRT1 |RPG1 |SHE2 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gonzalez-Aguilera C, et al. (2008) The THP1-SAC3-SUS1-CDC31 complex works in transcription elongation-mRNA export preventing RNA-mediated genome instability. Mol Biol Cell 19(10):4310-8
       |DBP5 |HPR1 |MEX67 |MTR4 |NAB2 |NUP120 |NUP133 |NUP60 |NUP84 |PAP1 |RAT1 |RRP6 |SAC3 |SUB2 |MORE
Reviews
Hurt JA and Silver PA (2008) mRNA nuclear export and human disease. Dis Model Mech 1(2-3):103-8
       |DBP5 |MEX67 |MTR2 |NUP42 |SUB2 |YRA1
Fungal Related Genes/Proteins
Moon D, et al. (2008) The fission yeast homologue of Glel is essential for growth and involved in mRNA export. J Microbiol 46(4):422-8

Protein-protein Interactions
Substrates/Ligands/Cofactors
Patel SS and Rexach MF (2008) Discovering novel interactions at the nuclear pore complex using bead halo: a rapid method for detecting molecular interactions of high and low affinity at equilibrium. Mol Cell Proteomics 7(1):121-31
       |ASM4 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP53 |NUP60 |NUP84 |POM34 |SEH1 |SRM1 |MORE
Protein-protein Interactions
Rougemaille M, et al. (2008) THO/Sub2p functions to coordinate 3'-end processing with gene-nuclear pore association. Cell 135(2):308-21
       |HPR1 |HSP104 |MEX67 |MFT1 |NUP116 |NUP60 |PAP1 |PCF11 |RNA14 |RNA15 |SUB2 |THO2
Cellular Location
Computational analysis
Protein Physical Properties
Protein-protein Interactions
Protein/Nucleic Acid Structure
Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94
           |ASM4 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location
Evolution
Protein/Nucleic Acid Structure
Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701
           |ASM4 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Reviews
Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73
       |ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |NMD3 |MORE
Protein-protein Interactions
Techniques and Reagents
Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6
       |ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Cellular Location
Function/Process
Protein Sequence Features
Protein-protein Interactions
Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96
         |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP157 |NUP159 |NUP170 |NUP192 |NUP2 |MORE
Reviews
Stewart M (2007) Ratcheting mRNA out of the Nucleus. Mol Cell 25(3):327-30
       |DBP5 |MEX67 |MTR2
Reviews
Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310
       |ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MAD1 |MORE
Function/Process
Genetic Interactions
Regulatory Role
Strains/Constructs
Substrates/Ligands/Cofactors
Alcazar-Roman AR, et al. (2006) Inositol hexakisphosphate and Gle1 activate the DEAD-box protein Dbp5 for nuclear mRNA export. Nat Cell Biol 8(7):711-6
       |DBP5 |DHH1 |IPK1 |NUP42
Evolution
Fungal Related Genes/Proteins
De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81
       |AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Cellular Location
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
           |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein Physical Properties
Protein Sequence Features
Regulation of
Regulatory Role
Substrates/Ligands/Cofactors
Weirich CS, et al. (2006) Activation of the DExD/H-box protein Dbp5 by the nuclear-pore protein Gle1 and its coactivator InsP6 is required for mRNA export. Nat Cell Biol 8(7):668-76
         |ARG82 |DBP5 |IPK1 |NUP159 |NUP42 |PLC1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52
           |ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
Non-Fungal Related Genes/Proteins
Kendirgi F, et al. (2005) Interaction between the shuttling mRNA export factor Gle1 and the nucleoporin hCG1: a conserved mechanism in the export of Hsp70 mRNA. Mol Biol Cell 16(9):4304-15
       |NUP42
Mutants/Phenotypes
Luna R, et al. (2005) Interdependence between transcription and mRNP processing and export, and its impact on genetic stability. Mol Cell 18(6):711-22
         |BRR6 |CAF20 |CCR4 |CDC40 |CFT1 |CRM1 |DBP1 |DBP5 |DBP7 |DCP1 |FIP1 |GBP2 |HRB1 |HRP1 |MORE
Cellular Location
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Miller AL, et al. (2004) Cytoplasmic inositol hexakisphosphate production is sufficient for mediating the Gle1-mRNA export pathway. J Biol Chem 279(49):51022-32
       |GLE2 |IPK1 |MSS4 |NUP116 |NUP159 |NUP42
Cellular Location
Function/Process
Rollenhagen C, et al. (2004) The nuclear pore complex and the DEAD box protein Rat8p/Dbp5p have nonessential features which appear to facilitate mRNA export following heat shock. Mol Cell Biol 24(11):4869-79
       |DBP5 |NUP42
Cellular Location
Function/Process
Protein-protein Interactions
Strains/Constructs
Suntharalingam M, et al. (2004) Nuclear export of the yeast mRNA-binding protein Nab2 is linked to a direct interaction with Gfd1 and to Gle1 function. J Biol Chem 279(34):35384-91
       |DBP5 |GFD1 |NAB2
Protein Physical Properties
Protein Sequence Features
Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5
         |ASM4 |CDC31 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Cellular Location
Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
         |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Verbsky JW, et al. (2002) The synthesis of inositol hexakisphosphate. Characterization of human inositol 1,3,4,5,6-pentakisphosphate 2-kinase. J Biol Chem 277(35):31857-62
       |IPK1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Gleizes PE, et al. (2001) Ultrastructural localization of rRNA shows defective nuclear export of preribosomes in mutants of the Nup82p complex. J Cell Biol 155(6):923-36
       |DBP5 |GSP1 |NSP1 |NUP159 |NUP82 |NUP84
Function/Process
Mutants/Phenotypes
Strains/Constructs
Hilleren P and Parker R (2001) Defects in the mRNA export factors Rat7p, Gle1p, Mex67p, and Rat8p cause hyperadenylation during 3'-end formation of nascent transcripts. RNA 7(5):753-64
     |DBP5 |MEX67 |NUP159
Function/Process
Substrates/Ligands/Cofactors
Jensen TH, et al. (2001) A block to mRNA nuclear export in S. cerevisiae leads to hyperadenylation of transcripts that accumulate at the site of transcription. Mol Cell 7(4):887-98
       |DBP5 |HSP104 |MEX67 |MTR2 |NUP159 |NUP42 |SSA4
Cellular Location
Function/Process
Strains/Constructs
Strawn LA, et al. (2001) The GLFG regions of Nup116p and Nup100p serve as binding sites for both Kap95p and Mex67p at the nuclear pore complex. J Biol Chem 276(9):6445-52
       |DBP5 |GLE2 |KAP95 |MEX67 |MTR2 |NUP100 |NUP116
Reviews
Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75
       |ASM4 |CDC31 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |MORE
Function/Process
Protein-protein Interactions
Ho AK, et al. (2000) Assembly and preferential localization of Nup116p on the cytoplasmic face of the nuclear pore complex by interaction with Nup82p. Mol Cell Biol 20(15):5736-48
       |NSP1 |NUP116 |NUP159 |NUP82
Function/Process
Fungal Related Genes/Proteins
Ives EB, et al. (2000) Biochemical and functional characterization of inositol 1,3,4,5, 6-pentakisphosphate 2-kinases. J Biol Chem 275(47):36575-83
       |IPK1
Cellular Location
Protein Physical Properties
Strains/Constructs
Techniques and Reagents
Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51
       |AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MLP1 |MORE
Reviews
Ryan KJ and Wente SR (2000) The nuclear pore complex: a protein machine bridging the nucleus and cytoplasm. Curr Opin Cell Biol 12(3):361-71
       |CRM1 |KAP104 |KAP123 |KAP95 |LOS1 |MSN5 |MTR10 |NIC96 |NMD5 |NSP1 |NUP116 |NUP159 |NUP170 |NUP82 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89
       |CRM1 |CSE1 |DBP5 |FAL1 |GLE2 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR2 |MTR4 |MORE
Function/Process
Protein-protein Interactions
Techniques and Reagents
Takahashi Y, et al. (2000) Yeast Ulp1, an Smt3-specific protease, associates with nucleoporins. J Biochem 128(5):723-5
       |CDC3 |NUP42 |SMT3 |SYN8 |UIP3 |UIP4 |UIP5 |ULP1
Reviews
Taura T, et al. (2000) [Nuclear transport of hnRNP and mRNA] Tanpakushitsu Kakusan Koso 45(14):2378-87
     |MEX67
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Vainberg IE, et al. (2000) Nuclear export of heat shock and non-heat-shock mRNA occurs via similar pathways. Mol Cell Biol 20(11):3996-4005
       |MTR2 |NUP159 |NUP42 |RNA1 |SRM1
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Hodge CA, et al. (1999) Rat8p/Dbp5p is a shuttling transport factor that interacts with Rat7p/Nup159p and Gle1p and suppresses the mRNA export defect of xpo1-1 cells. EMBO J 18(20):5778-88
       |CRM1 |DBP5 |GFD1 |GSP1 |MEX67 |NUP159 |NUP42
Function/Process
Protein Sequence Features
Liu Y, et al. (1999) A Crm1p-independent nuclear export path for the mRNA-associated protein, Npl3p/Mtr13p. Proc Natl Acad Sci U S A 96(12):6739-44
       |CRM1 |MEX67 |MTR10 |NPL3 |SRP1
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Strahm Y, et al. (1999) The RNA export factor Gle1p is located on the cytoplasmic fibrils of the NPC and physically interacts with the FG-nucleoporin Rip1p, the DEAD-box protein Rat8p/Dbp5p and a new protein Ymr 255p. EMBO J 18(20):5761-77
       |DBP5 |GFD1 |NUP42
Reviews
Strasser K and Hurt E (1999) Nuclear RNA export in yeast. FEBS Lett 452(1-2):77-81
     |MEX67 |MTR10 |MTR2 |NPL3 |NSP1 |NUP120 |NUP145 |NUP159 |NUP82 |NUP85
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
York JD, et al. (1999) A phospholipase C-dependent inositol polyphosphate kinase pathway required for efficient messenger RNA export. Science 285(5424):96-100
       |IPK1 |NUP100 |PLC1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Hurwitz ME, et al. (1998) Two yeast nuclear pore complex proteins involved in mRNA export form a cytoplasmically oriented subcomplex. Proc Natl Acad Sci U S A 95(19):11241-5
       |NUP159 |NUP82
Reviews
Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64

Mutants/Phenotypes
Karpova TS, et al. (1998) Depolarization of the actin cytoskeleton is a specific phenotype in Saccharomyces cerevisiae. J Cell Sci 111 ( Pt 17)():2689-96
       |AAP1 |ACT1 |CAP2 |FUR1 |MYO1 |RRF1 |SAC6 |TPM1
Alias
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Snay-Hodge CA, et al. (1998) Dbp5p/Rat8p is a yeast nuclear pore-associated DEAD-box protein essential for RNA export. EMBO J 17(9):2663-76
       |DBP5
Non-Fungal Related Genes/Proteins
Watkins JL, et al. (1998) The human homologue of Saccharomyces cerevisiae Gle1p is required for poly(A)+ RNA export. Proc Natl Acad Sci U S A 95(12):6779-84

Cellular Location
Function/Process
Non-Fungal Related Genes/Proteins
Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34
       |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
Reviews
Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11

Reviews
Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
     |ACC1 |ASM4 |CBC2 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MTR4 |MORE
Alias
Function/Process
Mutants/Phenotypes
Strains/Constructs
Saavedra CA, et al. (1997) Yeast heat shock mRNAs are exported through a distinct pathway defined by Rip1p. Genes Dev 11(21):2845-56
       |GSP1 |NPL3 |NUP120 |NUP145 |NUP159 |NUP2 |NUP42 |SSA1 |SSA4
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Stutz F, et al. (1997) The yeast nucleoporin rip1p contributes to multiple export pathways with no essential role for its FG-repeat region. Genes Dev 11(21):2857-68
       |NUP42
Reviews
Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Alias
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Del Priore V, et al. (1996) The product of the Saccharomyces cerevisiae RSS1 gene, identified as a high-copy suppressor of the rat7-1 temperature-sensitive allele of the RAT7/NUP159 nucleoporin, is required for efficient mRNA export. Mol Biol Cell 7(10):1601-21
     |NUP159
Cellular Location
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Murphy R and Wente SR (1996) An RNA-export mediator with an essential nuclear export signal. Nature 383(6598):357-60
     |NUP100 |NUP42
Alias
Function/Process
Mutants/Phenotypes
Strains/Constructs
Noble SM and Guthrie C (1996) Identification of novel genes required for yeast pre-mRNA splicing by means of cold-sensitive mutations. Genetics 143(1):67-80
     |BRR1 |BRR2 |BRR4 |PRP16 |PRP22 |PRP28 |PRP8 |SKI2 |YSH1

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.