---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

BUD30/YDL151C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIV: 183900 to 183319 CDS: 183900 - 183319 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
BUD30	YDL151C		ORF, Dubious	S000002310
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2001-03-13. Gene name expires on 2003-06-20.
Description
Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; 96% of ORF overlaps the verified gene RPC53; diploid mutant displays a weak budding pattern phenotype in a systematic assay

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2001-03-14 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By ascospore formation Enyenihi AH and Saunders WS (2003) Large-scale functional genomic analysis of sporulation and meiosis in Saccharomyces cerevisiae. Genetics 163(1):47-54            IMP : Inferred from Mutant Phenotype Assigned on 2006-11-20 SGD cellular bud site selection Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70        IMP : Inferred from Mutant Phenotype Assigned on 2002-10-10 SGD positive regulation of transcription from RNA polymerase II promoter Enyenihi AH and Saunders WS (2003) Large-scale functional genomic analysis of sporulation and meiosis in Saccharomyces cerevisiae. Genetics 163(1):47-54            IMP : Inferred from Mutant Phenotype Assigned on 2006-11-20 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cellular_component unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2001-03-14 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forBUD30/YDL151C for BUD30 1) Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70        2) Fisk DG, et al. (2006) Saccharomyces cerevisiae S288C genome annotation: a working hypothesis. Yeast 23(12):857-65        3) Page N, et al. (2003) A Saccharomyces cerevisiae genome-wide mutant screen for altered sensitivity to K1 killer toxin. Genetics 163(3):875-94

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BUD30/YDL151C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BUD30/YDL151C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSTSLLF C-term LNECYPA Length(aa) 193 MW(Da) 20,893 pI 4.34 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.020   Codon Adaptation Index 0.092   Frequency of Optimal Codons 0.354   Hydropathicity of Protein 0.390   Aromaticity Score 0.104	10 20 30 40 50 | | | | | MSTSLLFSLSPSSSSSMRLRASNSFPILNFFLDLDATPSLSSSSASFSEL SAPLSIVSRPFCTRDDPLPSDLMNPLLKSPFSLTKFPAANGPLEITCVLF KYLAIRLCWPPAPVTLLFLLLKCFLSLPLLDSSSSFTLDAAASLSSLDFL ATAFGLNFNEGLADPPPLEEESFNDGKRPFPLLLLILNECYPA*

Protein Structures from PDB: proteins of known structure with sequence similarity to BUD30/YDL151C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
BUD30	2002-08-16	Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Nomenclature History Notes

Date	Note
2002-08-16	The name FYV3 was initially reserved for ORF YDL151C, but was never published.

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YDL151C	SGD Systematic Sequence

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
8 curated references; 0 references not yet curated
Mutants/Phenotypes	Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401	|AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Mutants/Phenotypes Strains/Constructs	Askree SH, et al. (2004) A genome-wide screen for Saccharomyces cerevisiae deletion mutants that affect telomere length. Proc Natl Acad Sci U S A 101(23):8658-63	|ADE12 |ADO1 |AGP2 |APE3 |ARG2 |ARV1 |ASC1 |ATG11 |BEM4 |BRE2 |BRO1 |BUD16 |CAX4 |CCW14 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process Mutants/Phenotypes	Enyenihi AH and Saunders WS (2003) Large-scale functional genomic analysis of sporulation and meiosis in Saccharomyces cerevisiae. Genetics 163(1):47-54	|ADA2 |ADY2 |AKR1 |APS3 |APT1 |ARC1 |ARG82 |ARO2 |ATF1 |ATG11 |ATG15 |ATG16 |ATG5 |BPH1 |MORE
Alias Mutants/Phenotypes Regulatory Role	Griffith JL, et al. (2003) Functional genomics reveals relationships between the retrovirus-like Ty1 element and its host Saccharomyces cerevisiae. Genetics 164(3):867-79	|APN1 |ARD1 |BEM1 |CBC2 |CTK1 |DBR1 |DOA4 |HOF1 |JNM1 |KCS1 |LSM1 |MCK1 |MFT1 |NAT1 |MORE
Alias Mutants/Phenotypes Strains/Constructs	Ran H, et al. (2003) Human targets of Pseudomonas aeruginosa pyocyanin. Proc Natl Acad Sci U S A 100(24):14315-20	|BNA2 |BSD2 |CAT5 |CCM1 |CDC50 |CLN2 |COQ1 |DOA4 |ERG24 |FEN1 |FIG2 |GAS1 |GET2 |MRPL17 |MORE
Mutants/Phenotypes Strains/Constructs	Desmoucelles C, et al. (2002) Screening the yeast "disruptome" for mutants affecting resistance to the immunosuppressive drug, mycophenolic acid. J Biol Chem 277(30):27036-44	|ANP1 |CTK1 |CTK3 |DAL81 |DST1 |ERG24 |ERG3 |ERG4 |ERG5 |ERG6 |GCN5 |HOM2 |HPR1 |HTZ1 |MORE
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70	|ALG8 |BUD13 |BUD14 |BUD16 |BUD17 |BUD19 |BUD20 |BUD21 |BUD22 |BUD23 |BUD25 |BUD26 |BUD27 |BUD28 |MORE

Return to SGD

Send a Message to the SGD Curators