CYK3/YDL117W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIV: 248581 to 251238
CDS: 248581 - 251238

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

CYK3 YDL117W ORF, Verified S000002275

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2000-08-08. Gene name expires on 2001-08-08.
Description
SH3-domain protein located in the mother-bud neck and the cytokinetic actin ring; mutant phenotype and genetic interactions suggest a role in cytokinesis

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2001-02-12 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0131
Assigned on 2007-05-23 UniProtKB
cell division GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0132
Assigned on 2007-05-23 UniProtKB
Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
cytokinesis Korinek WS, et al. (2000) Cyk3, a novel SH3-domain protein, affects cytokinesis in yeast. Curr Biol 10(15):947-50
       IGI : Inferred from Genetic Interaction
Assigned on 2001-02-12 SGD
reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
cellular bud neck Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91
         IDA : Inferred from Direct Assay
Assigned on 2003-10-28 SGD
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0029
Assigned on 2008-02-13 UniProtKB
cytoplasm Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91
         IDA : Inferred from Direct Assay
Assigned on 2003-10-28 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0963
Assigned on 2008-02-14 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0086
Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forCYK3/YDL117W for CYK3
1) Korinek WS, et al. (2000) Cyk3, a novel SH3-domain protein, affects cytokinesis in yeast. Curr Biol 10(15):947-50

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for CYK3/YDL117W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for CYK3/YDL117W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MATNLTS

C-term FAEWLCV

Length(aa) 885

MW(Da) 100,620

pI 9.64

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.045

Codon Adaptation Index 0.136

Frequency of Optimal Codons 0.432

Hydropathicity of Protein -0.536

Aromaticity Score 0.098

10 20 30 40 50 | | | | | MATNLTSLKPPFKVKARYGWSGQTKGDLGFLEGDIMEVTRIAGSWFYGKL LRNKKCSGYFPHNFVILLEERLNSSTENGRQPSKIVESFEKSNKVVIPPV PSRYSDERPRPKKKLSSSMPNSPKKPVDSLTKARKAKSKEMVNEKNIYNT QSSRHHNNSAPNLPLASHSKPQVRNFEESMNNPLPPLPPLPDLDNMRKTD KRAPKKSYSANDLHMARSSREYNYYKDNQKFYDGFIPEKRYSLEEDSISS GLFSNSQYLNDSACSSENSFALMSDFSATSAGSFARHKYAQSFSDSLQRS QNANGCSTKINDSQEFGDSNASSRNGKMGDILRKIIIPKRNTNIYSSSVS SPKSPKAYPKLPDIQNLNLSATPDEARDWIAVKCHLNRARTLTKYDKHPR YMRALEENRDLILHPQDSIYNGLNTNEVKGNTKPGLVDVELAELNIEYID KMTWKRCIRDGTMTLDSWAQTTFSARYSTVLEKLRGIYIFCTEMFALTDD NGTSDFSAEPQNLEKILYRKHCTPYELTWLFKKLANSLGITCEIVIGFLK TPSAINWEFKYNHCWLRILVNKEWRFIDVILGNVTNPIHEFVNNRKIKKA ENSYFLMAPLEMIYTHIPPREFEQHIVPSIDQLSALYLPLVFPSFFKNEL KLYKFSTALSFLEDSEIYECSLEIPNDVEVFASVVIPTDNEEASSAYRNM ELALTQIKKQKAESGRRIALIKAVLPPNVNKGSLYIHSGVRGTQTSIANI HPLSMMVPLTHKGSNMKYEFVIKIPSESIQKIELYIVEPQSRYLFVGNEY SFEVIQSPSDGIVYSSDEGPNQNRKQPMAIKSPSGRVHELVKSDPHFPYG TWKGSIKIKEPGVWSALVIADSGIGWSVFAEWLCV*

Protein Structures from PDB: proteins of known structure with sequence similarity to CYK3/YDL117W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
CYK3 2000-09-06 SGD (2007) Information without a citation in SGD

Standard Name	Date Standardized	Reference
CYK3	2000-09-06	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YDL117W SGD Systematic Sequence

851440 NCBI: Gene ID

NP_010166.1 NCBI: RefSeq protein version ID

NP_010166.1 NCBI: RefSeq protein version ID

6320086 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YDL117W	SGD Systematic Sequence
851440	NCBI: Gene ID
NP_010166.1	NCBI: RefSeq protein version ID
NP_010166.1	NCBI: RefSeq protein version ID
6320086	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
23 curated references; 0 references not yet curated
Protein Physical Properties
Protein Sequence Features
Protein/Nucleic Acid Structure
Fernandez-Ballester G, et al. (2009) Structure-based prediction of the Saccharomyces cerevisiae SH3-ligand interactions. J Mol Biol 388(4):902-16
       |ABP1 |BBC1 |BEM1 |BOI1 |BOI2 |BZZ1 |HOF1 |HSE1 |LSB1 |LSB3 |MYO3 |MYO5 |NBP2 |PEX13 |MORE
Cellular Location
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Jendretzki A, et al. (2009) Cyk3 acts in actomyosin ring independent cytokinesis by recruiting Inn1 to the yeast bud neck. Mol Genet Genomics 282(4):437-51
       |HOF1 |INN1 |IQG1 |MYO1
Cellular Location
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Nishihama R, et al. (2009) Role of Inn1 and its interactions with Hof1 and Cyk3 in promoting cleavage furrow and septum formation in S. cerevisiae. J Cell Biol 185(6):995-1012
       |BNI1 |BNI5 |CDC12 |CDC14 |CDC5 |CHS2 |ELM1 |GIN4 |HOF1 |INN1 |IQG1 |MLC1 |MYO1 |PSA1
Regulation of
Transcription
Ohtsuki K, et al. (2009) Genome-wide localization analysis of a complete set of Tafs reveals a specific effect of the taf1 mutation on Taf2 occupancy and provides indirect evidence for different TFIID conformations at different promoters. Nucleic Acids Res
       |ARF1 |BAP3 |BUR6 |CDC48 |CDC53 |CDC9 |COP1 |DLD3 |DOS2 |GCN5 |HEM12 |HNT1 |HTB1 |IPT1 |MORE
Protein Sequence Features
Substrates/Ligands/Cofactors
Tonikian R, et al. (2009) Bayesian modeling of the yeast SH3 domain interactome predicts spatiotemporal dynamics of endocytosis proteins. PLoS Biol 7(10):e1000218
     |ABP1 |AIM21 |BBC1 |BEM1 |BOI1 |BOI2 |BSP1 |BUD14 |BZZ1 |CDC25 |FUS1 |HOF1 |HSE1 |LSB1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Zou J, et al. (2009) Regulation of cell polarity through phosphorylation of Bni4 by Pho85 G1 cyclin-dependent kinases in Saccharomyces cerevisiae. Mol Biol Cell 20(14):3239-50
       |AIM44 |APL3 |AXL1 |BCK1 |BEM1 |BEM2 |BNI1 |BNI4 |BNR1 |BOI1 |BOP3 |BUD22 |BUD3 |BUD4 |MORE
Mutants/Phenotypes
Giorgini F, et al. (2008) Histone deacetylase inhibition modulates kynurenine pathway activation in yeast, microglia, and mice expressing a mutant huntingtin fragment. J Biol Chem 283(12):7390-400
       |AIM21 |ARG7 |ATG32 |BFR1 |BNA4 |DEF1 |HSP104 |INM2 |MBF1 |MGT1 |MSO1 |NHP6A |PAF1 |PHO87 |MORE
Mutants/Phenotypes
Bicknell AA, et al. (2007) A novel role in cytokinesis reveals a housekeeping function for the unfolded protein response. J Cell Biol 177(6):1017-27
     |BNI1 |CHS2 |ERO1 |HAC1 |HOF1 |MLC2
Cellular Location
Genetic Interactions
Strains/Constructs
Iwase M, et al. (2007) Shs1 Plays Separable Roles in Septin Organization and Cytokinesis in Saccharomyces cerevisiae. Genetics 177(1):215-29
       |CDC10 |CDC11 |CDC12 |CDC3 |IQG1 |MYO1 |SHS1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Ko N, et al. (2007) Identification of Yeast IQGAP (Iqg1p) as an Anaphase-Promoting-Complex Substrate and Its Role in Actomyosin-Ring-Independent Cytokinesis. Mol Biol Cell 18(12):5139-53
       |AMA1 |APC1 |APC11 |APC2 |APC4 |APC5 |APC9 |CDC16 |CDC20 |CDC23 |CDC26 |CDC27 |CDH1 |CLB2 |MORE
Fungal Related Genes/Proteins
Protein Sequence Features
Beltrao P and Serrano L (2005) Comparative genomics and disorder prediction identify biologically relevant SH3 protein interactions. PLoS Comput Biol 1(3):e26
         |ABP1 |BBC1 |BCK1 |BEM1 |BOI1 |BOI2 |BUD14 |BZZ1 |CDC25 |DNF1 |DNF2 |FUS1 |HOF1 |HSE1 |MORE
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Conde R, et al. (2003) Screening for new yeast mutants affected in mannosylphosphorylation of cell wall mannoproteins. Yeast 20(14):1189-211
         |ALG12 |ALG9 |BRE5 |COG5 |COG7 |COG8 |ELP2 |EXG1 |HOC1 |ITC1 |KTR6 |LCL2 |LDB7 |MNN1 |MORE
Cellular Location
Strains/Constructs
Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91
         |AAH1 |AAP1 |ABZ1 |ABZ2 |ACB1 |ACO2 |ADD37 |ADD66 |ADE1 |ADE12 |ADE2 |ADE3 |ADE4 |ADE6 |MORE
Function/Process
Mutants/Phenotypes
Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53
       |ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE
Reviews
Prelich G (2002) RNA polymerase II carboxy-terminal domain kinases: emerging clues to their function. Eukaryot Cell 1(2):153-62
             |ABD1 |BUR2 |CAK1 |CCL1 |CEG1 |CSE2 |CTK1 |CTK2 |ELP2 |ELP3 |ELP4 |ELP6 |ESS1 |GAL11 |MORE
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2001) Systematic genetic analysis with ordered arrays of yeast deletion mutants. Science 294(5550):2364-8
           |ARC18 |ARC40 |ARP1 |ARP2 |ARP6 |ASE1 |ASF1 |ATS1 |BBC1 |BCK1 |BEM1 |BEM2 |BEM4 |BFA1 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42
             |AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |MORE
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Korinek WS, et al. (2000) Cyk3, a novel SH3-domain protein, affects cytokinesis in yeast. Curr Biol 10(15):947-50
       |ACT1 |HOF1 |IQG1
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Protein/Nucleic Acid Structure
Makarova KS, et al. (1999) A superfamily of archaeal, bacterial, and eukaryotic proteins homologous to animal transglutaminases. Protein Sci 8(8):1714-9
     |PNG1
Large-scale phenotype analysis
Mutants/Phenotypes
Strains/Constructs
Rieger KJ, et al. (1999) Chemotyping of yeast mutants using robotics. Yeast 15(10B):973-86
       |ADY3 |AIM22 |AIM6 |AMA1 |AQR1 |AZR1 |BIT61 |CAF40 |CSH1 |CST26 |CUS2 |DGK1 |DLS1 |DTR1 |MORE
Protein-protein Interactions
Cho RJ, et al. (1998) Parallel analysis of genetic selections using whole genome oligonucleotide arrays. Proc Natl Acad Sci U S A 95(7):3752-7
       |AHP1 |ASN1 |BUD6 |CIN2 |CIN4 |CNN1 |FIR1 |GAL1 |LYS9 |MDS3 |MID1 |MRE11 |NOC2 |NUP49 |MORE
Protein/Nucleic Acid Structure
Sanchez R and Sali A (1998) Large-scale protein structure modeling of the Saccharomyces cerevisiae genome. Proc Natl Acad Sci U S A 95(23):13597-602
       |BMS1 |MCT1 |SNT1 |YNL181W

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.