PMT5/YDL093W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIV: 289909 to 292140
CDS: 289909 - 292140

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

PMT5 YDL093W ORF, Verified S000002251

Description
Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine/threonine residues; acts in a complex with Pmt3p, can instead interact with Pmt2p in some conditions; target for new antifungals

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
dolichyl-phosphate-mannose-protein mannosyltransferase activity Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9
     TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
     IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.109
Assigned on 2007-05-23 UniProtKB
mannosyltransferase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003342
Assigned on 2007-05-23 UniProtKB
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0328
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
protein amino acid O-linked glycosylation Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9
     TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003342
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9
     TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003342 , EBI:IPR003608 , EBI:IPR016093
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
protein modifications

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forPMT5/YDL093W for PMT5
1) Girrbach V and Strahl S (2003) Members of the evolutionarily conserved PMT family of protein O-mannosyltransferases form distinct protein complexes among themselves. J Biol Chem 278(14):12554-62

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PMT5/YDL093W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PMT5/YDL093W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MNKEHLL

C-term YELNAES

Length(aa) 743

MW(Da) 84,775

pI 7.84

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.105

Codon Adaptation Index 0.155

Frequency of Optimal Codons 0.473

Hydropathicity of Protein 0.162

Aromaticity Score 0.155

10 20 30 40 50 | | | | | MNKEHLLKVDPIPDVTIKRGPLRSFLITKPCDNLSSLRTVTSSKEKLLVG CLLIFTAIVRLHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVHPPLVAM LYATVSSVFGYKGLFNYGNIGTEYTANVPYVAMRFFSATLGIVSVLVLYL TLRVSGVKIAVAAICAVCFAIENSFVTLSRFTLIEGPFVFFMACAVYFFR RSELYLPNSCKANKSLLAASIALGFAVSSKWAGLFTIAWAGIIVLWRVWF MIGDLSRPIGSSIKYMAFQFTCLLAIPAFIYFLIFSVHIKTLNVNGISSS FFPAEFRKTLKYNNVIKETVAEVAVGSAVSLNHVGTAGGYLHSHLHNYPA GSMQQQVTLYPHIDQNNKWIIELAEHPNENVTSFQNLTDGTIIKLRQLKN GCRLHSHDHKPPVSQNADWQKEVSCYGYEGFEGDINDDWIIEIDKKRSEP GPAQEHIRAIETKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCAYFARE DLTSWYIEENENEISLPNPEKVSYKKMSFWQKFVAIHKFMFYLNNYMDTS HAYSSEPKTWPLMLRGIDFWNENGREVYFLGNAVLWWSVTAFICTFIIGV AVELLAWKLGVNILRDKHIINFHYQVFQYLLGFAAHYFPYFFVGQKLFLY DYLPAYYFGILAFGHALDLISTYISNKRNNTGYIVVAIFMVVCFYFFSEH SPLIYATGWSSNLCKRSKWLGSWDFYCNSLLLSDSHYELNAES*

Protein Structures from PDB: proteins of known structure with sequence similarity to PMT5/YDL093W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to PMT5 Homolog Source (per PDB) Protein Alignment: PMT5 vs. Homolog External Links
P-Value %Identical %Similar Alignment
1t9f ( Chain: A)
Structural genomics of caenorhabditis elegans: structure of a protein with unknown function
PDB_Info
PDB_Structure
Caenorhabditis elegans 2.5e-08 33 26 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
PMT5 SGD (2007) Information without a citation in SGD

Standard Name	Reference
PMT5	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YDL093W SGD Systematic Sequence

851464 NCBI: Gene ID

NP_010190.1 NCBI: RefSeq protein version ID

NP_010190.1 NCBI: RefSeq protein version ID

6320109 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YDL093W	SGD Systematic Sequence
851464	NCBI: Gene ID
NP_010190.1	NCBI: RefSeq protein version ID
NP_010190.1	NCBI: RefSeq protein version ID
6320109	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
19 curated references; 0 references not yet curated
Reviews
Chiba Y and Akeboshi H (2009) Glycan engineering and production of 'humanized' glycoprotein in yeast cells. Biol Pharm Bull 32(5):786-95
       |KTR6 |MNN1 |MNN4 |OCH1 |PMT1 |PMT2 |PMT3 |PMT4 |PMT6
Strains/Constructs
Techniques and Reagents
Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif
       |AAC1 |AAC3 |ADP1 |ALG3 |ALG7 |BOR1 |CHO1 |DGA1 |DPP1 |ENA5 |EPT1 |GPT2 |LPP1 |NFT1 |MORE
Reviews
Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |MORE
Reviews
Lengeler KB, et al. (2008) Protein-O-mannosyltransferases in virulence and development. Cell Mol Life Sci 65(4):528-44
       |AGA1 |AGA2 |AXL2 |BAR1 |CIS3 |CTS1 |FUS1 |GAS1 |HSP150 |KEX2 |KRE9 |MID2 |PIR1 |PIR3 |MORE
Cell Cycle Phase Involved
Mutants/Phenotypes
Regulation of
Strains/Constructs
Niu W, et al. (2008) Mechanisms of Cell Cycle Control Revealed by a Systematic and Quantitative Overexpression Screen in S. cerevisiae. PLoS Genet 4(7):e1000120
         |ACT1 |AIM20 |ALG6 |AME1 |ARC1 |ARF1 |ASK1 |ATG26 |AVO2 |BET4 |BUL1 |CBF1 |CDC31 |CDC39 |MORE
Regulation of
Transcription
van den Brink J, et al. (2008) New insights into the Saccharomyces cerevisiae fermentation switch: dynamic transcriptional response to anaerobicity and glucose-excess. BMC Genomics 9:100
       |ACE2 |ALG7 |ARE1 |AUS1 |BAS1 |DAL5 |DAN1 |DAN4 |DNF2 |FAA4 |FET4 |FHL1 |GCN4 |GLN3 |MORE
Reviews
Goto M (2007) Protein o-glycosylation in fungi: diverse structures and multiple functions. Biosci Biotechnol Biochem 71(6):1415-27
       |BAR1 |CTS1 |GAS1 |HSP150 |KEX2 |KRE2 |KRE9 |KTR1 |KTR3 |PMT1 |PMT2 |PMT3 |PMT4 |PMT6 |MORE
Genetic Interactions
Large-scale genetic interaction
Mutants/Phenotypes
Strains/Constructs
Jain S, et al. (2007) Identification of a Novel Lysophospholipid Acyltransferase in Saccharomyces cerevisiae. J Biol Chem 282(42):30562-9
       |ALE1 |FEN1 |SLC1
Computational analysis
Protein-protein Interactions
Larsen P, et al. (2007) A statistical method to incorporate biological knowledge for generating testable novel gene regulatory interactions from microarray experiments. BMC Bioinformatics 8:317
     |CDC45 |HEK2 |HHF1 |HHT1 |HSL1 |HTA1 |HTA2 |HTB1 |HTB2 |HTZ1 |KCC4 |MNN1 |PMT1 |PMT2 |MORE
Reviews
Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |MORE
RNA Levels and Processing
Regulation of
Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91
         |AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Frieman MB and Cormack BP (2004) Multiple sequence signals determine the distribution of glycosylphosphatidylinositol proteins between the plasma membrane and cell wall in Saccharomyces cerevisiae. Microbiology 150(Pt 10):3105-14
       |FLO1 |FLO9 |KRE2 |KTR1 |KTR3 |MNN1 |MNN9 |PMT1 |PMT2 |PMT3 |PMT4 |PMT6
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Protein/Nucleic Acid Structure
Substrates/Ligands/Cofactors
Girrbach V and Strahl S (2003) Members of the evolutionarily conserved PMT family of protein O-mannosyltransferases form distinct protein complexes among themselves. J Biol Chem 278(14):12554-62
       |PMT1 |PMT2 |PMT3 |PMT4
Fungal Related Genes/Proteins
Protein Sequence Features
Girrbach V, et al. (2000) Structure-function analysis of the dolichyl phosphate-mannose: protein O-mannosyltransferase ScPmt1p. J Biol Chem 275(25):19288-96
       |PMT1 |PMT2 |PMT3 |PMT4 |PMT6
Function/Process
Fungal Related Genes/Proteins
Romero PA, et al. (1999) Mnt2p and Mnt3p of Saccharomyces cerevisiae are members of the Mnn1p family of alpha-1,3-mannosyltransferases responsible for adding the terminal mannose residues of O-linked oligosaccharides. Glycobiology 9(10):1045-51
       |MNN1 |MNT2 |MNT3 |MNT4 |PMT1 |PMT2 |PMT3 |PMT4 |PMT6
Strains/Constructs
Timpel C, et al. (1998) Multiple functions of Pmt1p-mediated protein O-mannosylation in the fungal pathogen Candida albicans. J Biol Chem 273(33):20837-46
       |PMT1 |PMT2 |PMT3 |PMT4 |PMT6
Function/Process
Fungal Related Genes/Proteins
Gentzsch M and Tanner W (1997) Protein-O-glycosylation in yeast: protein-specific mannosyltransferases. Glycobiology 7(4):481-6
     |AGA2 |BAR1 |CTS1 |GAS1 |HSP150 |KEX2 |KRE9 |PMT1 |PMT2 |PMT3 |PMT4 |PMT6
DNA/RNA Sequence Features
Mapping
Boskovic J, et al. (1996) The sequence of a 16,691 bp segment of Saccharomyces cerevisiae chromosome IV identifies the DUN1, PMT1, PMT5, SRP14 and DPR1 genes, and five new open reading frames. Yeast 12(13):1377-84
     |BUG1 |DUN1 |OPI6 |PMT1 |RAM1 |SRP14 |UBX3 |YDL094C
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Substrates/Ligands/Cofactors
Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9
     |GAS1 |PMT1 |PMT2 |PMT3 |PMT4 |PMT6 |PMT7

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.