---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SRP14/YDL092W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIV: 292781 to 293221 CDS: 292781 - 293221 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SRP14	YDL092W		ORF, Verified	S000002250
Description
Signal recognition particle (SRP) subunit, interacts with the RNA component of SRP to form the Alu domain, which is the region of SRP responsible for arrest of nascent chain elongation during membrane targeting; homolog of mammalian SRP14

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By 7S RNA binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003210 , EBI:IPR009018 Assigned on 2008-02-13 UniProtKB RNA binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0694 Assigned on 2008-02-14 UniProtKB endoplasmic reticulum signal peptide binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003210 Assigned on 2008-04-01 UniProtKB signal sequence binding Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400      IPI : Inferred from Physical Interaction Assigned on 2003-05-27 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By SRP-dependent cotranslational protein targeting to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003210 , EBI:IPR009018 Assigned on 2008-02-13 UniProtKB SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400      IC : Inferred By Curator from signal recognition particle, endoplasmic reticulum targeting Assigned on 2005-01-31 SGD negative regulation of translational elongation DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR009018 Assigned on 2008-04-01 UniProtKB protein targeting to ER Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400      IPI : Inferred from Physical Interaction Assigned on 2002-06-20 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cytoplasm GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0963 Assigned on 2008-02-14 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0086 Assigned on 2008-02-13 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0191 Assigned on 2008-02-13 UniProtKB ribonucleoprotein complex GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0687 Assigned on 2007-05-23 UniProtKB signal recognition particle DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR009018 Assigned on 2008-04-01 UniProtKB signal recognition particle, endoplasmic reticulum targeting Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400      IDA : Inferred from Direct Assay Assigned on 2002-06-20 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003210 Assigned on 2008-04-01 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0733 Assigned on 2008-02-14 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for SRP14/YDL092W for SRP14 The signal recognition particle (SRP) is an abundant and conserved ribonucleoprotein necessary for targeting proteins to the endoplasmic reticulum membrane (1). SRP in eukaryotes contains six subunits and a 7S RNA molecule; in S. cerevisiae the subunits are encoded by SRP14, SRP21, SRP68, SRP72, SEC65, and SRP54, and the RNA (termed scR1) is encoded by SCR1 (1, 2). With the exception of Srp54p, the proteins and RNA assemble into a core complex in the nucleus; this particle is exported to the cytoplasm where Srp54p joins to form the complete complex (3). Sec65p is required for association of Srp54p with the SRP particle (4). Loss of any of the SRP components causes a slow growth phenotype and loss of SRP-mediated translocation, but not cell death, indicating that the signal recognition particle is not essential in yeast and SRP-independent translocation can occur (1, 2). The first step of SRP-mediated cotranslational targeting is interaction between SRP and the ribosome nascent chain complex (RNC), which is comprised of the translating ribosome and the emerging nascent protein. SRP interacts with the RNC through the N-terminal hydrophobic signal sequence of the nascent protein. SRP then directs the RNC to the ER membrane via interaction between SRP and a signal receptor complex (SR), encoded by SRP101 and SRP102. Finally, the RNC is transferred to the translocon, a protein-conducting membrane channel, and SRP and the SR dissociate. GTP binding by both SRP (via the Srp54p subunit) and the SR is critical for their interaction, and GTP hydrolysis facilitates their dissociation (reviewed in 5, and see 5 for more details). Last Updated: 2008-08-11

Basic References [TOP]

BASIC INFORMATION REFERENCES forSRP14/YDL092W for SRP14 1) Hann BC and Walter P (1991) The signal recognition particle in S. cerevisiae. Cell 67(1):131-44        2) Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400      3) Ciufo LF and Brown JD (2000) Nuclear export of yeast signal recognition particle lacking Srp54p by the Xpo1p/Crm1p NES-dependent pathway. Curr Biol 10(20):1256-64        4) Stirling CJ and Hewitt EW (1992) The S. cerevisiae SEC65 gene encodes a component of yeast signal recognition particle with homology to human SRP19. Nature 356(6369):534-7      5) Wild K, et al. (2004) SRP meets the ribosome. Nat Struct Mol Biol 11(11):1049-53        6) Strub K, et al. (1999) The Alu domain homolog of the yeast signal recognition particle consists of an Srp14p homodimer and a yeast-specific RNA structure. RNA 5(10):1333-47      7) Mason N, et al. (2000) Elongation arrest is a physiologically important function of signal recognition particle. EMBO J 19(15):4164-74

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SRP14/YDL092W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SRP14/YDL092W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MANTGCL C-term NKVAKKN Length(aa) 146 MW(Da) 16,430 pI 10.51 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.030   Codon Adaptation Index 0.145   Frequency of Optimal Codons 0.437   Hydropathicity of Protein -0.829   Aromaticity Score 0.075	10 20 30 40 50 | | | | | MANTGCLSPGAFLSKVPEFFQTANEKHITVRLTAKRLIEHDPVEGNLEFD STNHPDYDVSKKASEISVSSRSDREYPLLIRMSYGSHDKKTKCSTVVKAS ELDQFWQEYSSVFKGGMQNLIKKKKKKSKNGTISKTGKKNKVAKKN*

Protein Structures from PDB: proteins of known structure with sequence similarity to SRP14/YDL092W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to SRP14 Homolog Source (per PDB) Protein Alignment: SRP14 vs. Homolog External Links P-Value %Identical %Similar Alignment 1914 ( Chain: A) Signal recognition particle alu rna binding heterodimer, srp9/14 PDB_Info PDB_Structure Mus musculus 0.003899 27 37 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SRP14	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YDL092W	SGD Systematic Sequence
851466	NCBI: Gene ID
NP_010191.1	NCBI: RefSeq protein version ID
NP_010191.1	NCBI: RefSeq protein version ID
6320111	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
19 curated references; 0 references not yet curated
Fungal Related Genes/Proteins Protein/Nucleic Acid Structure	Brooks MA, et al. (2009) Structure of SRP14 from the Schizosaccharomyces pombe signal recognition particle. Acta Crystallogr D Biol Crystallogr 65(Pt 5):421-33
Reviews	Fonzi WA (2009) The protein secretory pathway of Candida albicans. Mycoses	|BTT1 |EGD1 |EGD2 |GEA1 |GEA2 |GSG1 |NCE101 |NCE102 |SCR1 |SEC14 |SEC3 |SEC4 |SEC61 |SEC65 |MORE
Protein-protein Interactions Strains/Constructs	Xue X and Lehming N (2008) Nhp6p and Med3p regulate gene expression by controlling the local subunit composition of RNA polymerase II. J Mol Biol 379(2):212-30	|HHF1 |HHF2 |HHT1 |HHT2 |HTA1 |HTA2 |HTB1 |HTB2 |IMD2 |NHP6A |NHP6B |PGD1 |RPB4 |RTT107 |MORE
Regulation of Transcription	Kovalskaya ON, et al. (2006) Does a deficiency of the signal recognition particle (SRP)-pathway affect the biosynthesis of its components in Saccharomyces cerevisiae and Escherichia coli? Biochemistry (Mosc) 71(7):723-9	|SCR1 |SEC65 |SRP101 |SRP21 |SRP72
Function/Process Mutants/Phenotypes Strains/Constructs	Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7	|ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG1 |ERG10 |ERG12 |ERG13 |MORE
Reviews	Pool MR (2005) Signal recognition particles in chloroplasts, bacteria, yeast and mammals (review). Mol Membr Biol 22(1-2):3-15	|SCR1 |SEC65 |SRP101 |SRP21 |SRP54 |SRP68 |SRP72
Reviews	Dani HM, et al. (2003) Advances in the structure and functions of signal recognition particle in protein targeting. J Biol Regul Homeost Agents 17(4):303-7	|SRP54
Function/Process Mutants/Phenotypes Strains/Constructs	Willer M, et al. (2003) An in vitro assay using overexpressed yeast SRP demonstrates that cotranslational translocation is dependent upon the J-domain of Sec63p. Biochemistry 42(23):7171-7	|SCR1 |SEC63 |SEC65 |SRP21 |SRP54 |SRP68 |SRP72
Function/Process Genetic Interactions Mutants/Phenotypes Protein-Nucleic Acid Interactions Protein-protein Interactions Strains/Constructs	Grosshans H, et al. (2001) Biogenesis of the signal recognition particle (SRP) involves import of SRP proteins into the nucleolus, assembly with the SRP-RNA, and Xpo1p-mediated export. J Cell Biol 153(4):745-62	|CRM1 |DIS3 |KAP123 |MEX67 |MTR10 |NSP1 |NUP159 |NUP85 |PSE1 |RNA1 |RRP4 |SCR1 |SEC65 |SRM1 |MORE
Cellular Location Function/Process Protein Processing/Modification/Regulation Techniques and Reagents	Ciufo LF and Brown JD (2000) Nuclear export of yeast signal recognition particle lacking Srp54p by the Xpo1p/Crm1p NES-dependent pathway. Curr Biol 10(20):1256-64	|CRM1 |SCR1 |SEC65 |SRP21 |SRP54 |SRP68 |SRP72 |YRB2
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs Techniques and Reagents	Mason N, et al. (2000) Elongation arrest is a physiologically important function of signal recognition particle. EMBO J 19(15):4164-74	|SRP72
Function/Process Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-Nucleic Acid Interactions	Strub K, et al. (1999) The Alu domain homolog of the yeast signal recognition particle consists of an Srp14p homodimer and a yeast-specific RNA structure. RNA 5(10):1333-47	|SCR1
Non-Fungal Related Genes/Proteins	Birse DE, et al. (1997) The crystal structure of the signal recognition particle Alu RNA binding heterodimer, SRP9/14. EMBO J 16(13):3757-66
Function/Process Mutants/Phenotypes Protein Physical Properties Protein-protein Interactions Regulatory Role Techniques and Reagents	Thomas Y, et al. (1997) A truncation in the 14 kDa protein of the signal recognition particle leads to tertiary structure changes in the RNA and abolishes the elongation arrest activity of the particle. Nucleic Acids Res 25(10):1920-9
Other Features Techniques and Reagents	Zwieb C and Larsen N (1997) The Signal Recognition Particle Database (SRPDB). Nucleic Acids Res 25(1):107-8
Non-Fungal Related Genes/Proteins	Birse DE, et al. (1996) Crystallization and preliminary crystallographic analysis of the signal recognition particle SRPphi14-9 fusion protein. FEBS Lett 384(3):215-8
DNA/RNA Sequence Features Mapping Strains/Constructs	Boskovic J, et al. (1996) The sequence of a 16,691 bp segment of Saccharomyces cerevisiae chromosome IV identifies the DUN1, PMT1, PMT5, SRP14 and DPR1 genes, and five new open reading frames. Yeast 12(13):1377-84	|BUG1 |DUN1 |OPI6 |PMT1 |PMT5 |RAM1 |UBX3 |YDL094C
DNA/RNA Sequence Features Function/Process Non-Fungal Related Genes/Proteins Protein Physical Properties Protein Sequence Features Protein-protein Interactions Strains/Constructs Techniques and Reagents	Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400	|SCR1 |SEC65 |SRP21 |SRP54 |SRP68 |SRP72
Non-Fungal Related Genes/Proteins	Strub K and Walter P (1989) Isolation of a cDNA clone of the 14-kDa subunit of the signal recognition particle by cross-hybridization of differently primed polymerase chain reactions. Proc Natl Acad Sci U S A 86(24):9747-51

Return to SGD

Send a Message to the SGD Curators