ERP3/YDL018C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIV: 423508 to 422831
CDS: 423508 - 422831

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ERP3 YDL018C ORF, Verified S000002176

Description
Protein with similarity to Emp24p and Erv25p, member of the p24 family involved in ER to Golgi transport

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-09-30 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR000348
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle-mediated transport Marzioch M, et al. (1999) Erp1p and Erp2p, partners for Emp24p and Erv25p in a yeast p24 complex. Mol Biol Cell 10(6):1923-38
       ISA : Inferred from Sequence Alignment with SGD:ERV25, SGD:EMP24
Assigned on 2008-07-24 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0931
Assigned on 2008-02-14 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane Marzioch M, et al. (1999) Erp1p and Erp2p, partners for Emp24p and Erv25p in a yeast p24 complex. Mol Biol Cell 10(6):1923-38
       ISM : Inferred from Sequence Model
Assigned on 2008-07-24 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR000348
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9905
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forERP3/YDL018C for ERP3
1) Springer S, et al. (2000) The p24 proteins are not essential for vesicular transport in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 97(8):4034-9

2) Marzioch M, et al. (1999) Erp1p and Erp2p, partners for Emp24p and Erv25p in a yeast p24 complex. Mol Biol Cell 10(6):1923-38

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERP3/YDL018C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERP3/YDL018C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSNLCVL

C-term ESRKHNV

Length(aa) 225

MW(Da) 26,511

pI 6.84

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.076

Codon Adaptation Index 0.141

Frequency of Optimal Codons 0.471

Hydropathicity of Protein -0.520

Aromaticity Score 0.124

10 20 30 40 50 | | | | | MSNLCVLFFQFFFLAQFFAEASPLTFELNKGRKECLYTLTPEIDCTISYY FAVQQGESNDFDVNYEIFAPDDKNKPIIERSGERQGEWSFIGQHKGEYAI CFYGGKAHDKIVDLDFKYNCERQDDIRNERRKARKAQRNLRDSKTDPLQD SVENSIDTIERQLHVLERNIQYYKSRNTRNHHTVCSTEHRIVMFSIYGIL LIIGMSCAQIAILEFIFRESRKHNV*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERP3/YDL018C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
ERP3 SGD (2007) Information without a citation in SGD

Standard Name	Reference
ERP3	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YDL018C SGD Systematic Sequence

851544 NCBI: Gene ID

NP_010266.1 NCBI: RefSeq protein version ID

NP_010266.1 NCBI: RefSeq protein version ID

6320186 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YDL018C	SGD Systematic Sequence
851544	NCBI: Gene ID
NP_010266.1	NCBI: RefSeq protein version ID
NP_010266.1	NCBI: RefSeq protein version ID
6320186	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
10 curated references; 1 references not yet curated
Not yet curated Kurbatova E, et al. (2009) p24 proteins play a role in peroxisome proliferation in yeast. FEBS Lett 583(19):3175-80
       |EMP24
Non-Fungal Related Genes/Proteins
Boltz KA and Carney GE (2008) Loss of p24 function in Drosophila melanogaster causes a stress response and increased levels of NF-kappaB-regulated gene products. BMC Genomics 9:212
       |EMP24 |ERP1 |ERP2 |ERP4 |ERP5 |ERP6 |ERV25
Protein Physical Properties
White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36
         |ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |MORE
Regulation of
Transcription
Fry RC, et al. (2006) The DNA-damage signature in Saccharomyces cerevisiae is associated with single-strand breaks in DNA. BMC Genomics 7():313
         |AAH1 |AHP1 |ALG14 |AMN1 |ASF1 |BAT1 |BUD4 |CAC2 |CAR1 |CDC42 |CDC8 |CHA1 |CHS2 |CIC1 |MORE
RNA Levels and Processing
Guo Y, et al. (2006) Analysis of cellular responses to aflatoxin B(1) in yeast expressing human cytochrome P450 1A2 using cDNA microarrays. Mutat Res 593(1-2):121-42
           |AAT1 |AHA1 |ALD2 |ALD3 |ALK1 |APC1 |APC5 |APT2 |AQR1 |AQY2 |ARC40 |ARN1 |ARO10 |ARO9 |MORE
Regulation of
Transcription
Bean JM, et al. (2005) High functional overlap between MluI cell-cycle box binding factor and Swi4/6 cell-cycle box binding factor in the G1/S transcriptional program in Saccharomyces cerevisiae. Genetics 171(1):49-61
       |CDC21 |CDC45 |CDC6 |CLB2 |CLB5 |CLN2 |CLN3 |CWP1 |DUN1 |ELO1 |EXG1 |HCM1 |HTA2 |MBP1 |MORE
DNA/RNA Sequence Features
Regulation of
Transcription
Iyer VR, et al. (2001) Genomic binding sites of the yeast cell-cycle transcription factors SBF and MBF. Nature 409(6819):533-8
         |ABF1 |APN1 |BBP1 |BUD9 |CAP1 |CDC21 |CDC45 |CDC7 |CLA4 |CLB1 |CLB2 |CLB6 |CLD1 |CLN1 |MORE
Reviews
Kaiser C (2000) Thinking about p24 proteins and how transport vesicles select their cargo. Proc Natl Acad Sci U S A 97(8):3783-5
         |EMP24 |ERP1 |ERP2 |ERP4 |ERP5 |ERP6 |ERV25
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Springer S, et al. (2000) The p24 proteins are not essential for vesicular transport in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 97(8):4034-9
       |EMP24 |ERP1 |ERP2 |ERP4 |ERP5 |ERP6 |ERV25 |GAS1
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Marzioch M, et al. (1999) Erp1p and Erp2p, partners for Emp24p and Erv25p in a yeast p24 complex. Mol Biol Cell 10(6):1923-38
       |EMP24 |ERP1 |ERP2 |ERP4 |ERP5 |ERP6 |ERV25 |GAS1 |KAR2 |SEC13
DNA/RNA Sequence Features
Mutants/Phenotypes
Strains/Constructs
Tuller G, et al. (1999) Deletion of six open reading frames from the left arm of chromosome IV of Saccharomyces cerevisiae. Yeast 15(12):1275-85
       |GPM2 |NOP14 |OSH2 |TSC13 |YDL109C

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.