---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SBH1/YER087C-B Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrV: 332826 to 332578 CDS: 332826 - 332578 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SBH1	YER087C-B	SEB1, YER087C-A	ORF, Verified	S000002128
Description
Beta subunit of the Sec61p ER translocation complex (Sec61p-Sss1p-Sbh1p); involved in protein translocation into the endoplasmic reticulum; interacts with the exocyst complex and also with Rtn1p; homologous to Sbh2p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By ARF guanyl-nucleotide exchange factor activity Helmers J, et al. (2003) The beta-subunit of the protein-conducting channel of the endoplasmic reticulum functions as the guanine nucleotide exchange factor for the beta-subunit of the signal recognition particle receptor. J Biol Chem 278(26):23686-90        IDA : Inferred from Direct Assay Assigned on 2004-11-15 SGD contributes_to P-P-bond-hydrolysis-driven protein transmembrane transporter activity Panzner S, et al. (1995) Posttranslational protein transport in yeast reconstituted with a purified complex of Sec proteins and Kar2p. Cell 81(4):561-70        IDA : Inferred from Direct Assay Assigned on 2009-12-11 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By SRP-dependent cotranslational protein targeting to membrane, translocation Zhao X and Jantti J (2009) Functional characterization of the trans-membrane domain interactions of the Sec61 protein translocation complex beta-subunit. BMC Cell Biol 10():76              IMP : Inferred from Mutant Phenotype Assigned on 2009-12-11 SGD posttranslational protein targeting to membrane, translocation Panzner S, et al. (1995) Posttranslational protein transport in yeast reconstituted with a purified complex of Sec proteins and Kar2p. Cell 81(4):561-70        IDA : Inferred from Direct Assay Assigned on 2007-11-05 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Sec61 translocon complex Finke K, et al. (1996) A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. EMBO J 15(7):1482-94      IDA : Inferred from Direct Assay Assigned on 2009-12-11 SGD Panzner S, et al. (1995) Posttranslational protein transport in yeast reconstituted with a purified complex of Sec proteins and Kar2p. Cell 81(4):561-70        IDA : Inferred from Direct Assay Assigned on 2009-12-11 SGD endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9904 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for SBH1/YER087C-B for SBH1 SBH1 encodes the beta subunit of the heterotrimeric Sec61 complex, also referred to as the translocon (1, reviewed in 2). The Sec61 complex forms a channel in the endoplasmic reticulum (ER) membrane and mediates translocation of secretory and membrane proteins into the ER and also retrograde transport of misfolded proteins to the cytoplasm for degradation (reviewed in 3 and 2). The other subunits of the Sec61 complex are Sec61p, a 10-transmembrane domain protein that is the major translocon subunit, and Sss1p, a small essential protein thought to stabilize the complex (4, 5, 6). Proteins that are transported into or across the ER membrane are directed there by signal sequences or by transmembrane segments that interact with the translocation apparatus. In S. cerevisiae the Sec61 complex mediates both co- and posttranslational translocation (while the mammalian Sec61 complex functions primarily with the cotranslational pathway; 7). During cotranslational translocation, ribosomes synthesizing signal sequence-containing proteins are targeted to the translocon via the signal recognition particle (SRP), and the ribosomes bind directly to Sec61p such that protein biosynthesis and translocation are synchronous (8). Posttranslational translocation requires Sec62p, Sec63p, Sec66p, and Sec72p (comprising the Sec63 complex), as well as Kar2p, in place of SRP to facilitate interaction of the full-length polypeptide with the translocon via the signal sequence (9, 1). Retrograde transport of misfolded proteins into the cytoplasm (also called dislocation) employs the Sec61 channel via interaction with the 19S proteasome regulatory particle (10). This interaction, which competes with the ribosome-Sec61p interaction, defines the Sec61 complex as the principal proteasome receptor in the ER membrane (10). Sbh1p is a small protein with a single C-terminal transmembrane domain, and an N-terminal cytosolic region that has guanine nucleotide exchange factor (GEF) activity (11, 12). In contrast to the inviability conferred by null mutations in either SEC61 or SSS1, sbh1 null mutations do not cause a growth defect (13, 14, 15), and an sbh1 sbh2 double null mutant exhibits temperature (heat)-sensitive growth (15). Expression of the 25-amino acid transmembrane domain alone rescues the ts growth defect of the double null mutant, and this domain is sufficient for interaction with Sec61p and Sss1p to form the Sec61 complex (16). Physical interactions between Sbh1p and components of the exocyst complex, the oligosaccharyltransferase complex, and the signal peptidase complex have been reported (17, 18, 19, 16). Sbh1p is conserved among organisms; it is termed Sec61 beta in mammals, SecG in eubacteria, and Secbeta in archaea (reviewed in 20). Last Updated: 2007-11-09

Basic References [TOP]

BASIC INFORMATION REFERENCES forSBH1/YER087C-B for SBH1 1) Panzner S, et al. (1995) Posttranslational protein transport in yeast reconstituted with a purified complex of Sec proteins and Kar2p. Cell 81(4):561-70        2) Romisch K (1999) Surfing the Sec61 channel: bidirectional protein translocation across the ER membrane. J Cell Sci 112 ( Pt 23)():4185-91        3) Sommer T and Wolf DH (1997) Endoplasmic reticulum degradation: reverse protein flow of no return. FASEB J 11(14):1227-33      4) Esnault Y, et al. (1994) SSS1 encodes a stabilizing component of the Sec61 subcomplex of the yeast protein translocation apparatus. J Biol Chem 269(44):27478-85      5) Wilkinson BM, et al. (1997) Molecular architecture of the ER translocase probed by chemical crosslinking of Sss1p to complementary fragments of Sec61p. EMBO J 16(15):4549-59        6) Wilkinson BM, et al. (1996) Determination of the transmembrane topology of yeast Sec61p, an essential component of the endoplasmic reticulum translocation complex. J Biol Chem 271(41):25590-7        7) Ng DT, et al. (1996) Signal sequences specify the targeting route to the endoplasmic reticulum membrane. J Cell Biol 134(2):269-78      8) Prinz A, et al. (2000) Sec61p is the main ribosome receptor in the endoplasmic reticulum of Saccharomyces cerevisiae. Biol Chem 381(9-10):1025-9        9) Plath K, et al. (1998) Signal sequence recognition in posttranslational protein transport across the yeast ER membrane. Cell 94(6):795-807        10) Kalies KU, et al. (2005) The protein translocation channel binds proteasomes to the endoplasmic reticulum membrane. EMBO J 24(13):2284-93          11) Toikkanen J, et al. (1996) Yeast protein translocation complex: isolation of two genes SEB1 and SEB2 encoding proteins homologous to the Sec61 beta subunit. Yeast 12(5):425-38      12) Helmers J, et al. (2003) The beta-subunit of the protein-conducting channel of the endoplasmic reticulum functions as the guanine nucleotide exchange factor for the beta-subunit of the signal recognition particle receptor. J Biol Chem 278(26):23686-90        13) Deshaies RJ and Schekman R (1987) A yeast mutant defective at an early stage in import of secretory protein precursors into the endoplasmic reticulum. J Cell Biol 105(2):633-45      14) Esnault Y, et al. (1993) The yeast SSS1 gene is essential for secretory protein translocation and encodes a conserved protein of the endoplasmic reticulum. EMBO J 12(11):4083-93      15) Finke K, et al. (1996) A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. EMBO J 15(7):1482-94      16) Feng D, et al. (2007) The transmembrane domain is sufficient for Sbh1p function, its association with the Sec61 complex, and interaction with Rtn1p. J Biol Chem 282(42):30618-28        17) Antonin W, et al. (2000) Interactions between Spc2p and other components of the endoplasmic reticulum translocation sites of the yeast Saccharomyces cerevisiae. J Biol Chem 275(44):34068-72        18) Chavan M, et al. (2005) Subunits of the translocon interact with components of the oligosaccharyl transferase complex. J Biol Chem 280(24):22917-24        19) Toikkanen JH, et al. (2003) The beta subunit of the Sec61p endoplasmic reticulum translocon interacts with the exocyst complex in Saccharomyces cerevisiae. J Biol Chem 278(23):20946-53        20) Osborne AR, et al. (2005) Protein translocation by the Sec61/SecY channel. Annu Rev Cell Dev Biol 21():529-50

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SBH1/YER087C-B

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SBH1/YER087C-B

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSSPTPP C-term KVAGKLF Length(aa) 82 MW(Da) 8,711 pI 11.31 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.195   Codon Adaptation Index 0.183   Frequency of Optimal Codons 0.506   Hydropathicity of Protein 0.037   Aromaticity Score 0.061	10 20 30 40 50 | | | | | MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGL RVDPLVVLFLAVGFIFSVVALHVISKVAGKLF*

Protein Structures from PDB: proteins of known structure with sequence similarity to SBH1/YER087C-B, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SBH1	Panzner S, et al. (1995) Posttranslational protein transport in yeast reconstituted with a purified complex of Sec proteins and Kar2p. Cell 81(4):561-70

Nomenclature History Notes

Date	Note
2002-04-12	Previously, this ORF was called YER087C-A at SGD; however, MIPS had previously named a different ORF using the name YER087C-A. Thus, this locus has been renamed YER087C-B in SGD.

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YER087C-B	SGD Systematic Sequence
856821	NCBI: Gene ID
NP_011011.1	NCBI: RefSeq protein version ID
NP_011011.1	NCBI: RefSeq protein version ID
6320932	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
39 curated references; 0 references not yet curated
Non-Fungal Related Genes/Proteins	Becker T, et al. (2009) Structure of monomeric yeast and mammalian Sec61 complexes interacting with the translating ribosome. Science 326(5958):1369-73	|SBH2 |SEC61 |SSH1 |SSS1
Function/Process Protein-protein Interactions	Harada Y, et al. (2009) Oligosaccharyltransferase directly binds to ribosome at a location near the translocon-binding site. Proc Natl Acad Sci U S A 106(17):6945-9	|NIP7 |NMD3 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |RDN25-1 |RDN25-2 |RDN5-1 |RDN5-2 |RDN5-3 |RDN5-4 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs Techniques and Reagents	Zhao X and Jantti J (2009) Functional characterization of the trans-membrane domain interactions of the Sec61 protein translocation complex beta-subunit. BMC Cell Biol 10():76	|RTN1 |RTN2 |SBH2 |SEC61 |SSS1 |YOP1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Jiang Y, et al. (2008) An interaction between the SRP receptor and the translocon is critical during cotranslational protein translocation. J Cell Biol 180(6):1149-61	|SBH2 |SEC61 |SRP101 |SRP102 |SSH1 |SSS1
Cross-species Expression Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features	Leroux A and Rokeach LA (2008) Inter-Species Complementation of the Translocon Beta Subunit Requires Only Its Transmembrane Domain. PLoS ONE 3(12):e3880
Cellular Location Regulation of Strains/Constructs	Schuldiner M, et al. (2008) The GET complex mediates insertion of tail-anchored proteins into the ER membrane. Cell 134(4):634-45	|BOS1 |GET1 |GET2 |GET3 |GOS1 |KAR2 |PEP12 |PEX15 |SBH2 |SCS2 |SEC22 |SED5 |TLG2 |UBC6 |MORE
Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Feng D, et al. (2007) The transmembrane domain is sufficient for Sbh1p function, its association with the Sec61 complex, and interaction with Rtn1p. J Biol Chem 282(42):30618-28	|RTN1 |SBH2 |SEC15 |SEC61 |SEC62 |SEC63 |SSS1
Protein-protein Interactions	Ng W, et al. (2007) Characterization of the proteasome interaction with the Sec61 channel in the endoplasmic reticulum. J Cell Sci 120(Pt 4):682-91	|CDC48 |CUE1 |HRD1 |KAR2 |RPT1 |RPT3 |RPT5 |RPT6 |SEC61 |SEC62 |SEC63 |SEC72 |SSH1 |SSM4 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Function/Process Protein-protein Interactions Strains/Constructs Techniques and Reagents	Chavan M, et al. (2005) Subunits of the translocon interact with components of the oligosaccharyl transferase complex. J Biol Chem 280(24):22917-24	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |SEC61 |SSS1 |STT3 |SWP1 |WBP1
Protein-protein Interactions	Cheng Z, et al. (2005) Identification of cytoplasmic residues of Sec61p involved in ribosome binding and cotranslational translocation. J Cell Biol 168(1):67-77	|SEC61 |SSH1 |SSS1
Function/Process Protein-protein Interactions	Kalies KU, et al. (2005) The protein translocation channel binds proteasomes to the endoplasmic reticulum membrane. EMBO J 24(13):2284-93	|PRE1 |RPN1 |RPN10 |RPN11 |RPN12 |RPN13 |RPN2 |RPN3 |RPN5 |RPN6 |RPN7 |RPN8 |RPN9 |RPT1 |MORE
Reviews	Osborne AR, et al. (2005) Protein translocation by the Sec61/SecY channel. Annu Rev Cell Dev Biol 21():529-50	|KAR2 |SBH2 |SEC61 |SSH1 |SSS1
Function/Process Genetic Interactions	Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19	|ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Protein-protein Interactions Strains/Constructs	Yan A and Lennarz WJ (2005) Two oligosaccharyl transferase complexes exist in yeast and associate with two different translocons. Glycobiology 15(12):1407-15	|ALG1 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |SBH2 |SWP1 |WBP1
Fungal Related Genes/Proteins	Toikkanen JH, et al. (2004) Kluyveromyces lactis SSO1 and SEB1 genes are functional in Saccharomyces cerevisiae and enhance production of secreted proteins when overexpressed. Yeast 21(12):1045-55	|SEC4 |SSO1 |SSO2
Genetic Interactions	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process	Helmers J, et al. (2003) The beta-subunit of the protein-conducting channel of the endoplasmic reticulum functions as the guanine nucleotide exchange factor for the beta-subunit of the signal recognition particle receptor. J Biol Chem 278(26):23686-90	|SBH2 |SEC61 |SEC7 |SRP54
Non-Fungal Related Genes/Proteins	Lipschutz JH, et al. (2003) The exocyst affects protein synthesis by acting on the translocation machinery of the endoplasmic reticulum. J Biol Chem 278(23):20954-60	|SEC10 |SEC15 |SEC61
Function/Process Protein-protein Interactions	Scheper W, et al. (2003) Coordination of N-glycosylation and protein translocation across the endoplasmic reticulum membrane by Sss1 protein. J Biol Chem 278(39):37998-8003	|SEC61 |SSS1 |WBP1
Alias Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Toikkanen JH, et al. (2003) The beta subunit of the Sec61p endoplasmic reticulum translocon interacts with the exocyst complex in Saccharomyces cerevisiae. J Biol Chem 278(23):20946-53	|SEC15 |SEC4 |SEC61 |SEC8 |SSS1
Function/Process Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Yabal M, et al. (2003) Translocation of the C terminus of a tail-anchored protein across the endoplasmic reticulum membrane in yeast mutants defective in signal peptide-driven translocation. J Biol Chem 278(5):3489-96	|KAR2 |LHS1 |SBH2 |SEC61 |SEC62 |SEC63
Mutants/Phenotypes Strains/Constructs	Boisrame A, et al. (2002) Sbh1p, a subunit of the Sec61 translocon, interacts with the chaperone calnexin in the yeast Yarrowia lipolytica. J Cell Sci 115(Pt 24):4947-56	|SBH2 |SEC61
Function/Process Genetic Interactions Mutants/Phenotypes Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs Techniques and Reagents	Morrow MW and Brodsky JL (2001) Yeast ribosomes bind to highly purified reconstituted Sec61p complex and to mammalian p180. Traffic 2(10):705-16	|KAR2 |SEC61 |SEC62 |SEC63 |SEC66 |SEC72 |SSS1 |TEF2
Function/Process	Xiao Z, et al. (2001) [Cloning and expression of Trichoderma reesei endoglucanase III (EG III) gene in Saccharomyces cerevasiae] Wei Sheng Wu Xue Bao 41(4):391-6	|SSO2
Cellular Location Function/Process Protein-protein Interactions Regulation of	Antonin W, et al. (2000) Interactions between Spc2p and other components of the endoplasmic reticulum translocation sites of the yeast Saccharomyces cerevisiae. J Biol Chem 275(44):34068-72	|SBH2 |SEC11 |SEC61 |SPC1 |SPC2 |SPC3 |SSH1 |SSS1
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Prinz A, et al. (2000) Sec61p is the main ribosome receptor in the endoplasmic reticulum of Saccharomyces cerevisiae. Biol Chem 381(9-10):1025-9	|SEC61 |SSH1 |SSS1
Cellular Location Function/Process Protein-protein Interactions	Jensen RE and Johnson AE (1999) Protein translocation: is Hsp70 pulling my chain? Curr Biol 9(20):R779-82	|KAR2 |SEC61 |SSC1 |SSS1
Cellular Location Function/Process Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure	Rapoport TA, et al. (1999) Posttranslational protein translocation across the membrane of the endoplasmic reticulum. Biol Chem 380(10):1143-50	|SEC61 |SSS1
Cellular Location Function/Process Protein-protein Interactions	Plath K, et al. (1998) Signal sequence recognition in posttranslational protein transport across the yeast ER membrane. Cell 94(6):795-807	|KAR2 |SEC61 |SEC62 |SEC66 |SSS1
Cellular Location Function/Process Non-Fungal Related Genes/Proteins Protein-protein Interactions Techniques and Reagents	Beckmann R, et al. (1997) Alignment of conduits for the nascent polypeptide chain in the ribosome-Sec61 complex. Science 278(5346):2123-6	|SEC61 |SSS1
Cellular Location Function/Process Protein-protein Interactions Techniques and Reagents	Matlack KE, et al. (1997) Protein transport by purified yeast Sec complex and Kar2p without membranes. Science 277(5328):938-41	|KAR2 |SEC61 |SEC62 |SEC63 |SEC66 |SEC72 |SSS1
Cellular Location Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Plemper RK, et al. (1997) Mutant analysis links the translocon and BiP to retrograde protein transport for ER degradation. Nature 388(6645):891-5	|KAR2 |SEC61 |SEC63 |SSS1 |UBC6
DNA/RNA Sequence Features	Barry C, et al. (1996) A computer filtering method to drive out tiny genes from the yeast genome. Yeast 12(11):1163-78	|MDM35 |PAU7 |RPL29 |RTC6 |SBH2 |TIM10 |VMA10 |YBL113C
Protein Physical Properties Protein Processing/Modification/Regulation Protein-protein Interactions Strains/Constructs	Biederer T, et al. (1996) Degradation of subunits of the Sec61p complex, an integral component of the ER membrane, by the ubiquitin-proteasome pathway. EMBO J 15(9):2069-76	|SSS1 |UBC6 |UBC7
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Finke K, et al. (1996) A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. EMBO J 15(7):1482-94	|SBH2 |SEC61 |SEC62 |SEC63 |SEC66 |SEC72 |SSH1 |SSS1
Non-Fungal Related Genes/Proteins Protein-protein Interactions	Hanein D, et al. (1996) Oligomeric rings of the Sec61p complex induced by ligands required for protein translocation. Cell 87(4):721-32	|SEC61 |SEC62 |SEC63 |SEC72 |SSS1
Alias Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Physical Properties Strains/Constructs Techniques and Reagents	Toikkanen J, et al. (1996) Yeast protein translocation complex: isolation of two genes SEB1 and SEB2 encoding proteins homologous to the Sec61 beta subunit. Yeast 12(5):425-38	|SBH2 |SEC15
Function/Process Protein-protein Interactions Strains/Constructs Techniques and Reagents	Panzner S, et al. (1995) Posttranslational protein transport in yeast reconstituted with a purified complex of Sec proteins and Kar2p. Cell 81(4):561-70	|KAR2 |SEC61 |SEC72 |SSS1

Return to SGD

Send a Message to the SGD Curators