SBH2/YER019C-A Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrV: 194538 to 194272
CDS: 194538 - 194272

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

SBH2 YER019C-A SEB2 ORF, Verified S000002127

Description
Ssh1p-Sss1p-Sbh2p complex component, involved in protein translocation into the endoplasmic reticulum; homologous to Sbh1p

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
ARF guanyl-nucleotide exchange factor activity Helmers J, et al. (2003) The beta-subunit of the protein-conducting channel of the endoplasmic reticulum functions as the guanine nucleotide exchange factor for the beta-subunit of the signal recognition particle receptor. J Biol Chem 278(26):23686-90
       IDA : Inferred from Direct Assay
Assigned on 2004-11-15 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
SRP-dependent cotranslational protein targeting to membrane Jiang Y, et al. (2008) An interaction between the SRP receptor and the translocon is critical during cotranslational protein translocation. J Cell Biol 180(6):1149-61
       IGI : Inferred from Genetic Interaction with SGD:SBH1
Assigned on 2009-12-11 SGD
protein maturation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
protein processing Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0811
Assigned on 2009-10-01 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
Ssh1 translocon complex Finke K, et al. (1996) A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. EMBO J 15(7):1482-94
     IDA : Inferred from Direct Assay
Assigned on 2009-12-11 SGD
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9904
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forSBH2/YER019C-A for SBH2
1) Toikkanen J, et al. (1996) Yeast protein translocation complex: isolation of two genes SEB1 and SEB2 encoding proteins homologous to the Sec61 beta subunit. Yeast 12(5):425-38

2) Finke K, et al. (1996) A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. EMBO J 15(7):1482-94

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SBH2/YER019C-A

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SBH2/YER019C-A

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MAASVPP

C-term TKFTHII

Length(aa) 88

MW(Da) 9,606

pI 11.24

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.357

Codon Adaptation Index 0.206

Frequency of Optimal Codons 0.609

Hydropathicity of Protein 0.031

Aromaticity Score 0.080

10 20 30 40 50 | | | | | MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLY TDEANGFRVDSLVVLFLSVGFIFSVIALHLLTKFTHII*

Protein Structures from PDB: proteins of known structure with sequence similarity to SBH2/YER019C-A, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
SBH2 Finke K, et al. (1996) A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. EMBO J 15(7):1482-94

Standard Name	Reference
SBH2	*Finke K, et al.* (1996)** A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. EMBO J 15(7):1482-94

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YER019C-A SGD Systematic Sequence

NP_010936.1 NCBI: RefSeq protein version ID

NP_010936.1 NCBI: RefSeq protein version ID

856740 NCBI: Gene ID

6320857 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YER019C-A	SGD Systematic Sequence
NP_010936.1	NCBI: RefSeq protein version ID
NP_010936.1	NCBI: RefSeq protein version ID
856740	NCBI: Gene ID
6320857	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
20 curated references; 0 references not yet curated
Mutants/Phenotypes
Strains/Constructs
Banuelos MG, et al. (2009) Genomic analysis of severe hypersensitivity to hygromycin B reveals linkage to vacuolar defects and new vacuolar gene functions in Saccharomyces cerevisiae. Curr Genet
     |ARF1 |BUD32 |BUR2 |CHC1 |CIN5 |CPA1 |DBP7 |DHH1 |DRS2 |ERG6 |GET2 |GLN3 |HHY1 |ISM1 |MORE
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Protein/Nucleic Acid Structure
Becker T, et al. (2009) Structure of monomeric yeast and mammalian Sec61 complexes interacting with the translating ribosome. Science 326(5958):1369-73
       |SBH1 |SEC61 |SSH1 |SSS1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Zhao X and Jantti J (2009) Functional characterization of the trans-membrane domain interactions of the Sec61 protein translocation complex beta-subunit. BMC Cell Biol 10():76
             |RTN1 |RTN2 |SBH1 |SEC61 |SSS1 |YOP1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Jiang Y, et al. (2008) An interaction between the SRP receptor and the translocon is critical during cotranslational protein translocation. J Cell Biol 180(6):1149-61
       |SBH1 |SEC61 |SRP101 |SRP102 |SSH1 |SSS1
Cellular Location
Regulation of
Strains/Constructs
Schuldiner M, et al. (2008) The GET complex mediates insertion of tail-anchored proteins into the ER membrane. Cell 134(4):634-45
       |BOS1 |GET1 |GET2 |GET3 |GOS1 |KAR2 |PEP12 |PEX15 |SBH1 |SCS2 |SEC22 |SED5 |TLG2 |UBC6 |MORE
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Feng D, et al. (2007) The transmembrane domain is sufficient for Sbh1p function, its association with the Sec61 complex, and interaction with Rtn1p. J Biol Chem 282(42):30618-28
       |RTN1 |SBH1 |SEC15 |SEC61 |SEC62 |SEC63 |SSS1
DNA/RNA Sequence Features
Ferreira TC, et al. (2007) The yeast genome may harbor hypoxia response elements (HRE). Comp Biochem Physiol C Toxicol Pharmacol 146(1-2):255-63
       |AFT1 |ALD6 |ARO9 |ASC1 |ATM1 |BUD7 |CIS3 |CTF19 |CWP1 |DAN1 |EXG1 |GIT1 |GLY1 |GPA2 |MORE
Evolution
Fungal Related Genes/Proteins
De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81
       |AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Function/Process
Protein-protein Interactions
Kalies KU, et al. (2005) The protein translocation channel binds proteasomes to the endoplasmic reticulum membrane. EMBO J 24(13):2284-93
         |PRE1 |RPN1 |RPN10 |RPN11 |RPN12 |RPN13 |RPN2 |RPN3 |RPN5 |RPN6 |RPN7 |RPN8 |RPN9 |RPT1 |MORE
Reviews
Osborne AR, et al. (2005) Protein translocation by the Sec61/SecY channel. Annu Rev Cell Dev Biol 21():529-50
           |KAR2 |SBH1 |SEC61 |SSH1 |SSS1
Protein-protein Interactions
Strains/Constructs
Yan A and Lennarz WJ (2005) Two oligosaccharyl transferase complexes exist in yeast and associate with two different translocons. Glycobiology 15(12):1407-15
         |ALG1 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |SBH1 |SWP1 |WBP1
Function/Process
Helmers J, et al. (2003) The beta-subunit of the protein-conducting channel of the endoplasmic reticulum functions as the guanine nucleotide exchange factor for the beta-subunit of the signal recognition particle receptor. J Biol Chem 278(26):23686-90
       |SBH1 |SEC61 |SEC7 |SRP54
Function/Process
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Yabal M, et al. (2003) Translocation of the C terminus of a tail-anchored protein across the endoplasmic reticulum membrane in yeast mutants defective in signal peptide-driven translocation. J Biol Chem 278(5):3489-96
       |KAR2 |LHS1 |SBH1 |SEC61 |SEC62 |SEC63
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Boisrame A, et al. (2002) Sbh1p, a subunit of the Sec61 translocon, interacts with the chaperone calnexin in the yeast Yarrowia lipolytica. J Cell Sci 115(Pt 24):4947-56
       |SBH1 |SEC61
Cellular Location
Function/Process
Protein-protein Interactions
Regulation of
Antonin W, et al. (2000) Interactions between Spc2p and other components of the endoplasmic reticulum translocation sites of the yeast Saccharomyces cerevisiae. J Biol Chem 275(44):34068-72
       |SBH1 |SEC11 |SEC61 |SPC1 |SPC2 |SPC3 |SSH1 |SSS1
DNA/RNA Sequence Features
Barry C, et al. (1996) A computer filtering method to drive out tiny genes from the yeast genome. Yeast 12(11):1163-78
     |MDM35 |PAU7 |RPL29 |RTC6 |SBH1 |TIM10 |VMA10 |YBL113C
Cellular Location
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Corsi AK and Schekman R (1996) Mechanism of polypeptide translocation into the endoplasmic reticulum. J Biol Chem 271(48):30299-302
       |SSS1
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Finke K, et al. (1996) A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. EMBO J 15(7):1482-94
     |SBH1 |SEC61 |SEC62 |SEC63 |SEC66 |SEC72 |SSH1 |SSS1
Reviews
Rapoport TA, et al. (1996) Approaching the mechanism of protein transport across the ER membrane. Curr Opin Cell Biol 8(4):499-504
     |SSS1
Alias
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Strains/Constructs
Techniques and Reagents
Toikkanen J, et al. (1996) Yeast protein translocation complex: isolation of two genes SEB1 and SEB2 encoding proteins homologous to the Sec61 beta subunit. Yeast 12(5):425-38
     |SBH1 |SEC15

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.