---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NIC96/YFR002W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVI: 150011 to 152530 CDS: 150011 - 152530 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NIC96	YFR002W		ORF, Verified	S000001898
Description
Component of the nuclear pore complex, required for nuclear pore formation; forms a subcomplex with Nsp1p, Nup57p, and Nup49p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal subunit export from nucleus Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007231 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Nic96 complex Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51        IDA : Inferred from Direct Assay Assigned on 2009-10-14 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007231 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NIC96/YFR002W for NIC96 NIC96 encodes an abundant, essential nuclear pore protein (1, 2, 3). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 3, 4, 5, 6). The structure of the vertebrate NPC has been studied extensively; recent reviews include 7, 8, 9, and 10. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (11, 12). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 3, 4, 13, 14, 15). Nic96p is found in a subcomplex of the NPC, often called the Nsp1p subcomplex, that also contains Nsp1p, Nup49p, and Nup57p (3, 16, 1). This complex has been detected at both the nuclear and cytoplasmic periphery of the NPC central channel (17). Nic96p and the other most abundant nucleoporins, Pom152p, Nup157p, Nup170p, and Nup188p, may form the structural core of the NPC (3). Mutations in NIC96 cause defects in nuclear protein import (3); nic96 mutations are also synthetically lethal with mutations in other nucleoporin genes (18, 3). Proteins related to Nic96p have been identified in several other species, including S. pombe (19), C. elegans (20), and vertebrates (20, 21). Last Updated: 1999-08-05

Basic References [TOP]

BASIC INFORMATION REFERENCES forNIC96/YFR002W for NIC96 1) Grandi P, et al. (1993) Purification of NSP1 reveals complex formation with 'GLFG' nucleoporins and a novel nuclear pore protein NIC96. EMBO J 12(8):3061-71      2) Aitchison JD, et al. (1995) Two novel related yeast nucleoporins Nup170p and Nup157p: complementation with the vertebrate homologue Nup155p and functional interactions with the yeast nuclear pore-membrane protein Pom152p. J Cell Biol 131(5):1133-48      3) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      4) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    5) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      6) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      7) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      8) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      9) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      10) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      11) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      12) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        13) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      14) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        15) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      16) Schlaich NL, et al. (1997) In vitro reconstitution of a heterotrimeric nucleoporin complex consisting of recombinant Nsp1p, Nup49p, and Nup57p. Mol Biol Cell 8(1):33-46      17) Fahrenkrog B, et al. (1998) Molecular architecture of the yeast nuclear pore complex: localization of Nsp1p subcomplexes. J Cell Biol 143(3):577-88        18) Tcheperegine SE, et al. (1999) Topology and functional domains of the yeast pore membrane protein Pom152p. J Biol Chem 274(8):5252-8        19) Yoon JH, et al. (1997) Npp106p, a Schizosaccharomyces pombe nucleoporin similar to Saccharomyces cerevisiae Nic96p, functionally interacts with Rae1p in mRNA export. Mol Cell Biol 17(12):7047-60        20) Grandi P, et al. (1997) Nup93, a vertebrate homologue of yeast Nic96p, forms a complex with a novel 205-kDa protein and is required for correct nuclear pore assembly. Mol Biol Cell 8(10):2017-38        21) Allende ML, et al. (1996) Insertional mutagenesis in zebrafish identifies two novel genes, pescadillo and dead eye, essential for embryonic development. Genes Dev 10(24):3141-55      22) Grandi P, et al. (1995) Functional interaction of Nic96p with a core nucleoporin complex consisting of Nsp1p, Nup49p and a novel protein Nup57p. EMBO J 14(1):76-87      23) Zabel U, et al. (1996) Nic96p is required for nuclear pore formation and functionally interacts with a novel nucleoporin, Nup188p. J Cell Biol 133(6):1141-52      24) Bailer SM, et al. (2001) The Nsp1p carboxy-terminal domain is organized into functionally distinct coiled-coil regions required for assembly of nucleoporin subcomplexes and nucleocytoplasmic transport. Mol Cell Biol 21(23):7944-55

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NIC96/YFR002W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NIC96/YFR002W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MLETLRG C-term INIDVSL Length(aa) 839 MW(Da) 96,173 pI 6.81 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.090   Codon Adaptation Index 0.155   Frequency of Optimal Codons 0.462   Hydropathicity of Protein -0.365   Aromaticity Score 0.086

10 20 30 40 50 | | | | | MLETLRGNKLHSGTSKGANKKLNELLESSDNLPSASSELGSIQVSINELR RRVFQLRSKNKASKDYTKAHYLLANSGLSFEDVDAFIKDLQTNQFLEPNP PKIIESEELEFYIRTKKEENILMSIEQLLNGATKDFDNFINHNLNLDWAQ HKNEVMKNFGILIQDKKTVDHKKSISSLDPKLPSWGNKGNNILNSNESRL NVNENNILREKFENYARIVFQFNNSRQANGNFDIANEFISILSSANGTRN AQLLESWKILESMKSKDINIVEVGKQYLEQQFLQYTDNLYKKNMNEGLAT NVNKIKSFIDTKLKKADKSWKISNLTVINGVPIWALIFYLLRAGLIKEAL QVLVENKANIKKVEQSFLTYFKAYASSKDHGLPVEYSTKLHTEYNQHIKS SLDGDPYRLAVYKLIGRCDLSRKNIPAVTLSIEDWLWMHLMLIKEKDAEN DPVYERYSLEDFQNIIISYGPSRFSNYYLQTLLLSGLYGLAIDYTYTFSE MDAVHLAIGLASLKLFKIDSSTRLTKKPKRDIRFANILANYTKSFRYSDP RVAVEYLVLITLNEGPTDVELCHEALRELVLETKEFTVLLGKIGRDGARI PGVIEERQPLLHVRDEKEFLHTITEQAARRADEDGRIYDSILLYQLAEEY DIVITLVNSLLSDTLSASDLDQPLVGPDDNSETNPVLLARRMASIYFDNA GISRQIHVKNKEICMLLLNISSIRELYFNKQWQETLSQMELLDLLPFSDE LSARKKAQDFSNLDDNIVKNIPNLLIITLSCISNMIHILNESKYQSSTKG QQIDSLKNVARQCMIYAGMIQYRMPRETYSTLINIDVSL*

Protein Structures from PDB: proteins of known structure with sequence similarity to NIC96/YFR002W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to NIC96 Homolog Source (per PDB) Protein Alignment: NIC96 vs. Homolog External Links P-Value %Identical %Similar Alignment 2qx5 ( Chain: A, B) Structure of nucleoporin nic96 PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 9.9e-262 100 0 View alignment SCOP MMDB CATH Chain B = 9.9e-262 100 0 View alignment 2rfo ( Chain: A, B) Crystral structure of the nucleoporin nic96 PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 9.9e-262 100 0 View alignment SCOP MMDB CATH Chain B = 9.9e-262 100 0 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NIC96	Grandi P, et al. (1993) Purification of NSP1 reveals complex formation with 'GLFG' nucleoporins and a novel nuclear pore protein NIC96. EMBO J 12(8):3061-71

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YFR002W	SGD Systematic Sequence
850552	NCBI: Gene ID
NP_116657.1	NCBI: RefSeq protein version ID
NP_116657.1	NCBI: RefSeq protein version ID
14318524	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
69 curated references; 1 references not yet curated
Not yet curated	Titus LC, et al. (2010) Members of the RSC Chromatin-remodeling Complex Are Required for Maintaining Proper Nuclear Envelope Structure and Pore Complex Localization. Mol Biol Cell	|ARP7 |ARP9 |RSC4 |RSC58 |RSC8 |RSC9 |STH1
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NMD5 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP159 |NUP188 |MORE
Protein-protein Interactions	Luo Y, et al. (2010) Resolving the Composition of Protein Complexes Using a MALDI LTQ Orbitrap. J Am Soc Mass Spectrom 21(1):34-46	|APL1 |APL3 |APM4 |APS2 |ASM4 |BMH2 |EDE1 |FKS1 |NSP1 |NUP120 |NUP133 |NUP145 |NUP159 |NUP170 |MORE
RNA Levels and Processing	Chen AK, et al. (2009) Response of Saccharomyces cerevisiae to stress-free acidification. J Microbiol 47(1):1-8	|ACE2 |ACO1 |ARN1 |ARN2 |ARP4 |ATP1 |ATP16 |ATP2 |ATP3 |BRF1 |CAP1 |CAP2 |CBF5 |CCC2 |MORE
Cellular Location Mutants/Phenotypes Strains/Constructs	Dawson TR, et al. (2009) ER membrane-bending proteins are necessary for de novo nuclear pore formation. J Cell Biol 184(5):659-75	|GLE2 |NEM1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP188 |NUP49 |NUP82 |NUP84 |NUP85 |POM152 |POM34 |RTN1 |MORE
Evolution Non-Fungal Related Genes/Proteins	DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30	|MLP1 |MLP2 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |NUP2 |NUP82 |NUP84 |NUP85
Cellular Location	Kalocsay M, et al. (2009) Chromosome-wide Rad51 spreading and SUMO-H2A.Z-dependent chromosome fixation in response to a persistent DNA double-strand break. Mol Cell 33(3):335-43	|HEH2 |HTZ1 |MPS3 |RAD24 |RAD51 |RAD53 |RAD9 |RFA1 |SWR1
Reviews	Rexach M (2009) Piecing together nuclear pore complex assembly during interphase. J Cell Biol 185(3):377-9	|ASM4 |NDC1 |NUP157 |NUP170 |NUP188 |NUP53 |NUP82 |NUP84 |POM152 |POM34 |RTN1 |YOP1
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Protein Sequence Features Protein/Nucleic Acid Structure	Brohawn SG, et al. (2008) Structural evidence for common ancestry of the nuclear pore complex and vesicle coats. Science 322(5906):1369-73	|NUP133 |NUP145 |NUP84 |SEC13 |SEC31 |SEH1
Cellular Location Strains/Constructs	Harper NC, et al. (2008) Mutations affecting spindle pole body and mitotic exit network function are synthetically lethal with a deletion of the nucleoporin NUP1 in S. cerevisiae. Curr Genet 53(2):95-105	|BFA1 |BUB2 |DBF2 |LTE1 |NSP1 |NUD1 |NUP1 |NUP170 |NUP60 |SWI5
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hung NJ, et al. (2008) Arx1 Is a Nuclear Export Receptor for the 60S Ribosomal Subunit in Yeast. Mol Biol Cell 19(2):735-44	|ARX1 |CRM1 |GLE2 |MEX67 |MTR2 |NMD3 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP42 |NUP57 |NUP82 |MORE
Cellular Location	Marie C, et al. (2008) Cytoplasmic localization of sterol transcription factors Upc2p and Ecm22p in S. cerevisiae. Fungal Genet Biol 45(10):1430-8	|ECM22 |UPC2
Protein-protein Interactions	Patel SS and Rexach MF (2008) Discovering novel interactions at the nuclear pore complex using bead halo: a rapid method for detecting molecular interactions of high and low affinity at equilibrium. Mol Cell Proteomics 7(1):121-31	|ASM4 |GLE1 |KAP95 |NDC1 |NSP1 |NUP1 |NUP100 |NUP116 |NUP53 |NUP60 |NUP84 |POM34 |SEH1 |SRM1 |MORE
Mutants/Phenotypes Strains/Constructs	Shcheprova Z, et al. (2008) A mechanism for asymmetric segregation of age during yeast budding. Nature 454(7205):728-34	|BNR1 |BUD6 |CDC12 |FOB1 |MLP1 |MLP2 |NSG1 |NUP133 |NUP49 |PRM3 |SEC61 |SHS1
Protein-protein Interactions	Tarassov K, et al. (2008) An in vivo map of the yeast protein interactome. Science 320(5882):1465-70	|ACT1 |ARC40 |ARP2 |ATG27 |BEM1 |CDC11 |CHC1 |DHH1 |FMP42 |GYL1 |KEL1 |KEL2 |LAS17 |LSM4 |MORE
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Fungal Related Genes/Proteins	Cho HJ, et al. (2007) Schizosaccharomyces pombe nup97, which Genetically Interacts with mex67, is Essential for Growth and Involved in mRNA Export. J Microbiol 45(4):344-9	|MEX67
Cross-species Expression Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Physical Properties Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Jeudy S and Schwartz TU (2007) Crystal structure of nucleoporin nic96 reveals a novel, intricate helical domain architecture. J Biol Chem 282(48):34904-12
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |GLE2 |KAP95 |NDC1 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP157 |NUP159 |NUP170 |NUP192 |NUP2 |MORE
Genetic Interactions Strains/Constructs	Ryan KJ, et al. (2007) The karyopherin Kap95 regulates nuclear pore complex assembly into intact nuclear envelopes in vivo. Mol Biol Cell 18(3):886-98	|KAP95 |NUP170
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Protein-protein Interactions	West M, et al. (2007) Novel interaction of the 60S ribosomal subunit export adapter Nmd3 at the nuclear pore complex. J Biol Chem 282(19):14028-37	|CRM1 |NMD3 |NUP159 |NUP82 |NUP85
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |MORE
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Non-Fungal Related Genes/Proteins	Shang X, et al. (2006) Molecular cloning of the rice field eel Nup93 with predominant expression in gonad and kidney. Yi Chuan Xue Bao 33(1):41-8
Mutants/Phenotypes Strains/Constructs	Belanger KD, et al. (2005) Nuclear pore complex function in Saccharomyces cerevisiae is influenced by glycosylation of the transmembrane nucleoporin Pom152p. Genetics 171(3):935-47	|ALG12 |NUP1 |NUP116 |NUP82 |POM152
Protein Physical Properties Protein-protein Interactions Strains/Constructs	Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51	|GLE2 |KAP123 |MEX67 |MLP1 |NSP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP49 |NUP57 |MORE
Cellular Location	Yoder TJ, et al. (2005) Analysis of a spindle pole body mutant reveals a defect in biorientation and illuminates spindle forces. Mol Biol Cell 16(1):141-52	|ARP1 |KAR9 |MCD1 |NUF2 |SPC110 |SPC29 |SPC42 |SPC97 |TUB1
Protein-protein Interactions	Fahrenkrog B, et al. (2004) The S. cerevisiae HtrA-like protein Nma111p is a nuclear serine protease that mediates yeast apoptosis. J Cell Sci 117(Pt 1):115-26	|NMA111
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Lau CK, et al. (2004) A novel allele of Saccharomyces cerevisiae NDC1 reveals a potential role for the spindle pole body component Ndc1p in nuclear pore assembly. Eukaryot Cell 3(2):447-58	|NDC1 |NUP49
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Gao H, et al. (2003) Nuclear accumulation of the small GTPase Gsp1p depends on nucleoporins Nup133p, Rat2p/Nup120p, Nup85p, Nic96p, and the acetyl-CoA carboxylase Acc1p. J Biol Chem 278(28):25331-40	|ACC1 |GSP1 |NTF2 |NUP120 |NUP133 |NUP85 |SRM1
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Damelin M and Silver PA (2002) In situ analysis of spatial relationships between proteins of the nuclear pore complex. Biophys J 83(6):3626-36	|NUP116 |NUP120 |NUP82
Cellular Location Protein Processing/Modification/Regulation Strains/Constructs	Ryan KJ and Wente SR (2002) Isolation and characterization of new Saccharomyces cerevisiae mutants perturbed in nuclear pore complex assembly. BMC Genet 3():17	|BET3 |NUP170 |SEC13 |SEC23 |SEC27
Cellular Location Protein-protein Interactions	Bailer SM, et al. (2001) The Nsp1p carboxy-terminal domain is organized into functionally distinct coiled-coil regions required for assembly of nucleoporin subcomplexes and nucleocytoplasmic transport. Mol Cell Biol 21(23):7944-55	|NSP1 |NUP49 |NUP57 |NUP82
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |MORE
Cellular Location Function/Process Strains/Constructs	Fahrenkrog B, et al. (2000) Comparative spatial localization of protein-A-tagged and authentic yeast nuclear pore complex proteins by immunogold electron microscopy. J Struct Biol 129(2-3):295-305	|NSP1
Cellular Location Function/Process Protein-protein Interactions Strains/Constructs	Fahrenkrog B, et al. (2000) The yeast nucleoporin Nup53p specifically interacts with Nic96p and is directly involved in nuclear protein import. Mol Biol Cell 11(11):3885-96	|NUP53
Function/Process Mutants/Phenotypes Strains/Constructs	Gomez-Ospina N, et al. (2000) Yeast nuclear pore complex assembly defects determined by nuclear envelope reconstruction. J Struct Biol 132(1):1-5	|NUP192
Protein-protein Interactions	Kosova B, et al. (2000) Mlp2p, a component of nuclear pore attached intranuclear filaments, associates with nic96p. J Biol Chem 275(1):343-50	|MLP1 |MLP2
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Reviews	Ryan KJ and Wente SR (2000) The nuclear pore complex: a protein machine bridging the nucleus and cytoplasm. Curr Opin Cell Biol 12(3):361-71	|CRM1 |GLE1 |KAP104 |KAP123 |KAP95 |LOS1 |MSN5 |MTR10 |NMD5 |NSP1 |NUP116 |NUP159 |NUP170 |NUP82 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89	|CRM1 |CSE1 |DBP5 |FAL1 |GLE1 |GLE2 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR2 |MORE
Function/Process Non-Fungal Related Genes/Proteins Protein-protein Interactions Techniques and Reagents	Kosova B, et al. (1999) Nup192p is a conserved nucleoporin with a preferential location at the inner site of the nuclear membrane. J Biol Chem 274(32):22646-51	|NUP192 |NUP49
Genetic Interactions Mutants/Phenotypes	Tcheperegine SE, et al. (1999) Topology and functional domains of the yeast pore membrane protein Pom152p. J Biol Chem 274(8):5252-8	|ASM4 |NUP170 |NUP188 |POM152
Function/Process Protein-protein Interactions	Belgareh N, et al. (1998) Functional characterization of a Nup159p-containing nuclear pore subcomplex. Mol Biol Cell 9(12):3475-92	|NSP1 |NUP159 |NUP82
Cellular Location Function/Process Techniques and Reagents	Bucci M and Wente SR (1998) A novel fluorescence-based genetic strategy identifies mutants of Saccharomyces cerevisiae defective for nuclear pore complex assembly. Mol Biol Cell 9(9):2439-61	|GLE2 |NSP1 |NUP116 |NUP120 |NUP145 |NUP159 |NUP49 |NUP57 |NUP82 |POM152
Cellular Location Function/Process Strains/Constructs Techniques and Reagents	Fahrenkrog B, et al. (1998) Molecular architecture of the yeast nuclear pore complex: localization of Nsp1p subcomplexes. J Cell Biol 143(3):577-88	|NSP1 |NUP49 |NUP57 |NUP82
Genetic Interactions Mutants/Phenotypes	Ho AK, et al. (1998) The integral membrane protein snl1p is genetically linked to yeast nuclear pore complex function. Mol Biol Cell 9(2):355-73	|GLE2 |NUP100 |NUP116 |POM152 |SNL1
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Non-Fungal Related Genes/Proteins	Grandi P, et al. (1997) Nup93, a vertebrate homologue of yeast Nic96p, forms a complex with a novel 205-kDa protein and is required for correct nuclear pore assembly. Mol Biol Cell 8(10):2017-38	|NSP1 |NUP192
Mutants/Phenotypes Protein-protein Interactions	Schlaich NL, et al. (1997) In vitro reconstitution of a heterotrimeric nucleoporin complex consisting of recombinant Nsp1p, Nup49p, and Nup57p. Mol Biol Cell 8(1):33-46	|NSP1 |NUP49 |NUP57
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |NUP49 |MORE
Fungal Related Genes/Proteins	Yoon JH, et al. (1997) Npp106p, a Schizosaccharomyces pombe nucleoporin similar to Saccharomyces cerevisiae Nic96p, functionally interacts with Rae1p in mRNA export. Mol Cell Biol 17(12):7047-60	|GLE2
Non-Fungal Related Genes/Proteins	Allende ML, et al. (1996) Insertional mutagenesis in zebrafish identifies two novel genes, pescadillo and dead eye, essential for embryonic development. Genes Dev 10(24):3141-55
Mapping	Naitou M, et al. (1996) Sequencing of a 23 kb fragment from Saccharomyces cerevisiae chromosome VI. Yeast 12(1):77-84	|BLM10 |DEG1 |LOC1 |MSH4 |SEC4 |SPB4
Cellular Location Protein-protein Interactions	Nehrbass U, et al. (1996) The yeast nucleoporin Nup188p interacts genetically and physically with the core structures of the nuclear pore complex. J Cell Biol 133(6):1153-62	|NUP188 |POM152
Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions	Zabel U, et al. (1996) Nic96p is required for nuclear pore formation and functionally interacts with a novel nucleoporin, Nup188p. J Cell Biol 133(6):1141-52	|NUP188
Cellular Location Function/Process Genetic Interactions	Aitchison JD, et al. (1995) Two novel related yeast nucleoporins Nup170p and Nup157p: complementation with the vertebrate homologue Nup155p and functional interactions with the yeast nuclear pore-membrane protein Pom152p. J Cell Biol 131(5):1133-48	|NUP157 |NUP170 |NUP188 |POM152
Reviews	Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41	|NUP100 |NUP116 |NUP133 |NUP159 |NUP188 |NUP2 |NUP57 |NUP82 |NUP84 |NUP85 |POM152
Protein-protein Interactions	Grandi P, et al. (1995) A novel nuclear pore protein Nup82p which specifically binds to a fraction of Nsp1p. J Cell Biol 130(6):1263-73	|NSP1 |NUP49 |NUP57 |NUP82
Cellular Location Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Grandi P, et al. (1995) Functional interaction of Nic96p with a core nucleoporin complex consisting of Nsp1p, Nup49p and a novel protein Nup57p. EMBO J 14(1):76-87	|NSP1 |NUP49 |NUP57
DNA/RNA Sequence Features Mapping	Murakami Y, et al. (1995) Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae. Nat Genet 10(3):261-8	|AAD16 |AAD6 |ACT1 |AGP3 |AGX1 |ALR2 |BLM10 |BNA6 |BST1 |CAK1 |CDC14 |CDC26 |CDC4 |CEN6 |MORE
Cellular Location Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Grandi P, et al. (1993) Purification of NSP1 reveals complex formation with 'GLFG' nucleoporins and a novel nuclear pore protein NIC96. EMBO J 12(8):3061-71	|NSP1 |NUP49 |NUP57

Return to SGD

Send a Message to the SGD Curators