---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SEC4/YFL005W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVI: 130329 to 130976 CDS: 130329 - 130976 Genetic position: -6 cM Genetic Map Data Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SEC4	YFL005W	SRO6	ORF, Verified	S000001889
Description
Secretory vesicle-associated Rab GTPase essential for exocytosis; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By GTP binding Kabcenell AK, et al. (1990) Binding and hydrolysis of guanine nucleotides by Sec4p, a yeast protein involved in the regulation of vesicular traffic. J Biol Chem 265(16):9366-72      IDA : Inferred from Direct Assay Assigned on 2007-08-15 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001806 , EBI:IPR003579 , EBI:IPR005225 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0342 Assigned on 2007-05-23 UniProtKB GTPase activity Kabcenell AK, et al. (1990) Binding and hydrolysis of guanine nucleotides by Sec4p, a yeast protein involved in the regulation of vesicular traffic. J Biol Chem 265(16):9366-72      IDA : Inferred from Direct Assay Assigned on 2007-08-15 SGD enzyme regulator activity Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc nucleotide binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0547 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By Golgi to plasma membrane transport Hicke L, et al. (1997) Transport through the yeast endocytic pathway occurs through morphologically distinct compartments and requires an active secretory pathway and Sec18p/N-ethylmaleimide-sensitive fusion protein. Mol Biol Cell 8(1):13-31      IMP : Inferred from Mutant Phenotype Assigned on 2008-01-08 SGD ascospore-type prospore formation Neiman AM (1998) Prospore membrane formation defines a developmentally regulated branch of the secretory pathway in yeast. J Cell Biol 140(1):29-37        IMP : Inferred from Mutant Phenotype Assigned on 2006-06-14 SGD bipolar cellular bud site selection Pruyne D and Bretscher A (2000) Polarization of cell growth in yeast. J Cell Sci 113 ( Pt 4):571-85        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD cytokinesis Pruyne D and Bretscher A (2000) Polarization of cell growth in yeast. J Cell Sci 113 ( Pt 4):571-85        TAS : Traceable Author Statement Assigned on 2001-01-19 SGD exocytosis VerPlank L and Li R (2005) Cell cycle-regulated trafficking of Chs2 controls actomyosin ring stability during cytokinesis. Mol Biol Cell 16(5):2529-43        IDA : Inferred from Direct Assay Assigned on 2006-06-19 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0268 Assigned on 2007-05-23 UniProtKB membrane addition at site of cytokinesis Wagner W, et al. (2002) Mlc1p promotes septum closure during cytokinesis via the IQ motifs of the vesicle motor Myo2p. EMBO J 21(23):6397-408          IEP : Inferred from Expression Pattern IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction with SGD:MLC1 Assigned on 2006-10-19 SGD organelle fusion Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003579 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB small GTPase mediated signal transduction Pruyne D and Bretscher A (2000) Polarization of cell growth in yeast. J Cell Sci 113 ( Pt 4):571-85        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001806 , EBI:IPR003579 Assigned on 2007-05-23 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB vesicle fusion Hicke L, et al. (1997) Transport through the yeast endocytic pathway occurs through morphologically distinct compartments and requires an active secretory pathway and Sec18p/N-ethylmaleimide-sensitive fusion protein. Mol Biol Cell 8(1):13-31      IMP : Inferred from Mutant Phenotype Assigned on 2008-01-08 SGD vesicle organization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By actin cap Pruyne D and Bretscher A (2000) Polarization of cell growth in yeast. J Cell Sci 113 ( Pt 4):571-85        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD cytoplasm GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0963 Assigned on 2008-02-14 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0086 Assigned on 2008-02-13 UniProtKB cytoplasmic vesicle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0968 Assigned on 2009-06-29 UniProtKB incipient cellular bud site Ayscough KR, et al. (1997) High rates of actin filament turnover in budding yeast and roles for actin in establishment and maintenance of cell polarity revealed using the actin inhibitor latrunculin-A. J Cell Biol 137(2):399-416        IDA : Inferred from Direct Assay Assigned on 2005-03-14 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-02-14 UniProtKB mitochondrial outer membrane Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50          IDA : Inferred from Direct Assay Assigned on 2006-03-17 SGD mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12          IDA : Inferred from Direct Assay Assigned on 2004-09-28 SGD Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD plasma membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-1003 Assigned on 2009-06-29 UniProtKB plasma membrane enriched fraction Delom F, et al. (2006) The plasma membrane proteome of Saccharomyces cerevisiae and its response to the antifungal calcofluor. Proteomics 6(10):3029-39        IDA : Inferred from Direct Assay Assigned on 2009-04-29 SGD transport vesicle Toikkanen JH, et al. (2003) The beta subunit of the Sec61p endoplasmic reticulum translocon interacts with the exocyst complex in Saccharomyces cerevisiae. J Biol Chem 278(23):20946-53        TAS : Traceable Author Statement Assigned on 2003-06-23 SGD vesicle Wagner W, et al. (2002) Mlc1p promotes septum closure during cytokinesis via the IQ motifs of the vesicle motor Myo2p. EMBO J 21(23):6397-408          IDA : Inferred from Direct Assay Assigned on 2006-10-19 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forSEC4/YFL005W for SEC4 1) Guo W, et al. (1999) The exocyst is an effector for Sec4p, targeting secretory vesicles to sites of exocytosis. EMBO J 18(4):1071-80        2) Novick P and Schekman R (1979) Secretion and cell-surface growth are blocked in a temperature-sensitive mutant of Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 76(4):1858-62      3) Novick P, et al. (1980) Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15        4) Fields, C. and Schekman, R. (1985) Personal Communication, Mortimer Map Edition 9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SEC4/YFL005W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SEC4/YFL005W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSGLRTV C-term SSKSNCC Length(aa) 215 MW(Da) 23,506 pI 7.11 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.194   Codon Adaptation Index 0.196   Frequency of Optimal Codons 0.536   Hydropathicity of Protein -0.226   Aromaticity Score 0.074	10 20 30 40 50 | | | | | MSGLRTVSASSGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFI TTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVY DVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEAL AKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVGNGKEGNI SINSGSGNSSKSNCC*

Protein Structures from PDB: proteins of known structure with sequence similarity to SEC4/YFL005W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to SEC4 Homolog Source (per PDB) Protein Alignment: SEC4 vs. Homolog External Links P-Value %Identical %Similar Alignment 3cph ( Chain: A) Crystal structure of sec4 in complex with rab-gdi PDB_Info PDB_Structure Saccharomyces cerevisiae 8.8e-90 100 0 View alignment SCOP MMDB CATH 2ocy ( Chain: C) Complex of the guanine exchange factor sec2p and the rab gtpase sec4p PDB_Info PDB_Structure Saccharomyces cerevisiae 9.2e-71 100 0 View alignment SCOP MMDB CATH 1g17 ( Chain: A, B) Crystal structure of sec4-guanosine-5'-(beta,gamma)- imidotriphosphate PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 1.8e-70 99 1 View alignment SCOP MMDB CATH Chain B = 1.8e-70 99 1 View alignment 1g16 ( Chain: C, D, B, A) Crystal structure of sec4-gdp PDB_Info PDB_Structure Saccharomyces cerevisiae Chain C = 1.8e-70 99 1 View alignment SCOP MMDB CATH Chain D = 1.8e-70 99 1 View alignment Chain B = 1.8e-70 99 1 View alignment Chain A = 1.8e-70 99 1 View alignment 2eqb ( Chain: A) Crystal structure of the rab gtpase sec4p, the sec2p gef domain, and phosphate complex PDB_Info PDB_Structure Saccharomyces cerevisiae 3.0e-70 98 0 View alignment SCOP MMDB CATH 2fu5 ( Chain: D, C) Structure of rab8 in complex with mss4 PDB_Info PDB_Structure Homo sapiens | Mus musculus Chain D = 6.8e-45 59 28 View alignment SCOP MMDB CATH Chain C = 6.8e-45 59 28 View alignment 2rhd ( Chain: A) Crystal structure of cryptosporidium parvum small gtpase rab1a PDB_Info PDB_Structure Cryptosporidium parvum 3.0e-41 57 28 View alignment SCOP MMDB CATH 2fol ( Chain: A) Crystal structure of human rab1a in complex with gdp PDB_Info PDB_Structure Homo sapiens 3.3e-41 56 31 View alignment SCOP MMDB CATH 3cue ( Chain: X, F, R, L) Crystal structure of a trapp subassembly activating the rab ypt1p PDB_Info PDB_Structure Saccharomyces cerevisiae Chain X = 1.2e-40 49 34 View alignment SCOP MMDB CATH Chain F = 1.2e-40 49 34 View alignment Chain R = 1.2e-40 49 34 View alignment Chain L = 1.2e-40 49 34 View alignment 1ukv ( Chain: Y) Structure of rabgdp-dissociation inhibitor in complex with prenylated ypt1 gtpase PDB_Info PDB_Structure Saccharomyces cerevisiae 1.2e-40 49 34 View alignment SCOP MMDB CATH 2bcg ( Chain: Y) Structure of doubly prenylated ypt1:gdi complex PDB_Info PDB_Structure Saccharomyces cerevisiae 1.6e-40 49 34 View alignment SCOP MMDB CATH 1yzn ( Chain: A) Gppnhp-bound ypt1p gtpase PDB_Info PDB_Structure Saccharomyces cerevisiae 3.9e-38 54 31 View alignment SCOP MMDB CATH 3rab ( Chain: A) Gppnhp-bound rab3a at 2.0 a resolution PDB_Info PDB_Structure Rattus norvegicus 6.8e-38 53 33 View alignment SCOP MMDB CATH 1zbd ( Chain: A) Structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a PDB_Info PDB_Structure Rattus norvegicus 3.2e-37 53 32 View alignment SCOP MMDB CATH 2gf9 ( Chain: A) Crystal structure of human rab3d in complex with gdp PDB_Info PDB_Structure Homo sapiens 1.8e-36 50 34 View alignment SCOP MMDB CATH 3dz8 ( Chain: A) Crystal structure of human rab3b gtpase bound with gdp PDB_Info PDB_Structure Homo sapiens 4.3e-36 51 33 View alignment SCOP MMDB CATH 2g6b ( Chain: A) Crystal structure of human rab26 in complex with a gtp analogue PDB_Info PDB_Structure Homo sapiens 6.5e-36 51 28 View alignment SCOP MMDB CATH 2il1 ( Chain: A) Crystal structure of a predicted human gtpase in complex with gdp PDB_Info PDB_Structure Homo sapiens 7.2e-35 50 31 View alignment SCOP MMDB CATH 1z0a ( Chain: B, A, C, D) Gdp-bound rab2a gtpase PDB_Info PDB_Structure Homo sapiens Chain B = 8.9e-35 49 31 View alignment SCOP MMDB CATH Chain A = 8.9e-35 49 31 View alignment Chain C = 8.9e-35 49 31 View alignment Chain D = 8.9e-35 49 31 View alignment 2a5j ( Chain: A) Crystal structure of human rab2b PDB_Info PDB_Structure Homo sapiens 1.1e-33 48 31 View alignment SCOP MMDB CATH 3cpj ( Chain: B) Crystal structure of ypt31 in complex with yeast rab-gdi PDB_Info PDB_Structure Saccharomyces cerevisiae 1.2e-32 40 34 View alignment SCOP MMDB CATH 2ew1 ( Chain: A) Crystal structure of rab30 in complex with a gtp analogue PDB_Info PDB_Structure Homo sapiens 1.7e-32 48 33 View alignment SCOP MMDB CATH 1yzk ( Chain: A) Gppnhp bound rab11 gtpase PDB_Info PDB_Structure Homo sapiens 4.4e-32 48 34 View alignment SCOP MMDB CATH 1x3s ( Chain: A) Crystal structure of human rab18 in complex with gppnhp PDB_Info PDB_Structure Homo sapiens 4.7e-32 50 30 View alignment SCOP MMDB CATH 1oiv ( Chain: B, A) X-ray structure of the small g protein rab11a in complex with gdp PDB_Info PDB_Structure Homo sapiens Chain B = 1.0e-31 48 34 View alignment SCOP MMDB CATH Chain A = 1.0e-31 48 34 View alignment 2f9l ( Chain: A) D structure of inactive human rab11b gtpase PDB_Info PDB_Structure Homo sapiens 2.1e-31 44 37 View alignment SCOP MMDB CATH 2f9m ( Chain: A) D structure of active human rab11b gtpase PDB_Info PDB_Structure Homo sapiens 2.1e-31 44 37 View alignment SCOP MMDB CATH 2d7c ( Chain: B, A) Crystal structure of human rab11 in complex with fip3 rab- binding domain PDB_Info PDB_Structure Homo sapiens Chain B = 3.9e-31 47 34 View alignment SCOP MMDB CATH Chain A = 3.9e-31 47 34 View alignment 2hv8 ( Chain: C, A, B) Crystal structure of gtp-bound rab11 in complex with fip3 PDB_Info PDB_Structure Homo sapiens Chain C = 4.1e-31 47 34 View alignment SCOP MMDB CATH Chain A = 4.1e-31 47 34 View alignment Chain B = 4.1e-31 47 34 View alignment 2gzd ( Chain: B, A) Crystal structure of rab11 in complex with rab11-fip2 PDB_Info PDB_Structure Homo sapiens Chain B = 4.1e-31 47 34 View alignment SCOP MMDB CATH Chain A = 4.1e-31 47 34 View alignment 2gzh ( Chain: A) Crystal structure of rab11 in complex with rab11-family interacting protein 2 PDB_Info PDB_Structure Homo sapiens 4.1e-31 47 34 View alignment SCOP MMDB CATH 1oix ( Chain: A) X-ray structure of the small g protein rab11a in complex with gdp and pi PDB_Info PDB_Structure Homo sapiens 4.6e-31 47 34 View alignment SCOP MMDB CATH 1oiw ( Chain: A) X-ray structure of the small g protein rab11a in complex with gtpgammas PDB_Info PDB_Structure Homo sapiens 4.6e-31 47 34 View alignment SCOP MMDB CATH 2f7s ( Chain: A, B) The crystal structure of human rab27b bound to gdp PDB_Info PDB_Structure Homo sapiens Chain A = 2.0e-30 45 32 View alignment SCOP MMDB CATH Chain B = 2.0e-30 45 32 View alignment 2aed ( Chain: A) Crystal structure of human rab14 PDB_Info PDB_Structure Homo sapiens 2.2e-30 43 36 View alignment SCOP MMDB CATH 3bfk ( Chain: A, D, C, E, B) Crystal structure of plasmodium falciparum rab11a in complex with gdp PDB_Info PDB_Structure Plasmodium falciparum 3D7 Chain A = 4.3e-30 49 28 View alignment SCOP MMDB CATH Chain D = 4.3e-30 49 28 View alignment Chain C = 4.3e-30 49 28 View alignment Chain E = 4.3e-30 49 28 View alignment Chain B = 4.3e-30 49 28 View alignment 1z0f ( Chain: A) Gdp-bound rab14 gtpase PDB_Info PDB_Structure Homo sapiens 1.1e-29 44 35 View alignment SCOP MMDB CATH 2iez ( Chain: H, I, B, A) Crystal structure of mouse rab27b bound to gdp in monoclinic space group PDB_Info PDB_Structure Mus musculus Chain H = 1.4e-29 41 32 View alignment SCOP MMDB CATH Chain I = 1.4e-29 41 32 View alignment Chain B = 1.4e-29 41 32 View alignment Chain A = 1.4e-29 41 32 View alignment 3bc1 ( Chain: A, E) Crystal structure of the complex rab27a-slp2a PDB_Info PDB_Structure Mus musculus | Homo sapiens Chain A = 2.1e-29 42 33 View alignment SCOP MMDB CATH Chain E = 2.1e-29 42 33 View alignment 2iey ( Chain: A, B) Crystal structure of mouse rab27b bound to gdp in hexagonal space group PDB_Info PDB_Structure Mus musculus Chain A = 2.4e-29 44 33 View alignment SCOP MMDB CATH Chain B = 2.4e-29 44 33 View alignment 2if0 ( Chain: B, A) Crystal structure of mouse rab27b bound to gdp in monoclinic space group PDB_Info PDB_Structure Mus musculus Chain B = 2.6e-29 44 33 View alignment SCOP MMDB CATH Chain A = 2.6e-29 44 33 View alignment 2hup ( Chain: B, A) Crystal structure of human rab43 in complex with gdp PDB_Info PDB_Structure Homo sapiens Chain B = 2.6e-29 46 31 View alignment SCOP MMDB CATH Chain A = 2.6e-29 46 31 View alignment 2zet ( Chain: B, A) Crystal structure of the small gtpase rab27b complexed with the slp homology domain of slac2-a/melanophilin PDB_Info PDB_Structure Mus musculus Chain B = 2.6e-29 44 33 View alignment SCOP MMDB CATH Chain A = 2.6e-29 44 33 View alignment 2bme ( Chain: B, A, D, C) High resolution structure of gppnhp-bound human rab4a PDB_Info PDB_Structure Homo sapiens Chain B = 8.9e-29 44 33 View alignment SCOP MMDB CATH Chain A = 8.9e-29 44 33 View alignment Chain D = 8.9e-29 44 33 View alignment Chain C = 8.9e-29 44 33 View alignment 2bmd ( Chain: A) High resolution structure of gdp-bound human rab4a PDB_Info PDB_Structure Homo sapiens 8.9e-29 44 33 View alignment SCOP MMDB CATH 2o52 ( Chain: A, B) Crystal structure of human rab4b in complex with gdp PDB_Info PDB_Structure Homo sapiens Chain A = 1.2e-28 45 32 View alignment SCOP MMDB CATH Chain B = 1.2e-28 45 32 View alignment 2p5s ( Chain: B, A) Rab domain of human rasef in complex with gdp PDB_Info PDB_Structure Homo sapiens Chain B = 9.8e-28 41 34 View alignment SCOP MMDB CATH Chain A = 9.8e-28 41 34 View alignment 1yu9 ( Chain: A) Gppnhp-bound rab4a PDB_Info PDB_Structure Homo sapiens 3.7e-27 43 33 View alignment SCOP MMDB CATH 2oil ( Chain: A) Crystal structure of human rab25 in complex with gdp PDB_Info PDB_Structure Homo sapiens 5.8e-27 43 35 View alignment SCOP MMDB CATH 1z0k ( Chain: A, C) Structure of gtp-bound rab4q67l gtpase in complex with the central rab binding domain of rabenosyn-5 PDB_Info PDB_Structure Homo sapiens Chain A = 1.6e-26 42 33 View alignment SCOP MMDB CATH Chain C = 1.6e-26 42 33 View alignment 2g77 ( Chain: B) Crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3 PDB_Info PDB_Structure Saccharomyces cerevisiae | Mus musculus 5.2e-26 42 32 View alignment SCOP MMDB CATH 2efc ( Chain: B, D) Ara7-gdp/atvps9a PDB_Info PDB_Structure Arabidopsis thaliana Chain B = 7.6e-26 43 32 View alignment SCOP MMDB CATH Chain D = 7.6e-26 43 32 View alignment 2efh ( Chain: D, B) Ara7-gdp/atvps9a(d185n) PDB_Info PDB_Structure Arabidopsis thaliana Chain D = 7.6e-26 43 32 View alignment SCOP MMDB CATH Chain B = 7.6e-26 43 32 View alignment 2efe ( Chain: D, B) Ara7-gdpnh2/atvps9a PDB_Info PDB_Structure Arabidopsis thaliana Chain D = 7.6e-26 43 32 View alignment SCOP MMDB CATH Chain B = 7.6e-26 43 32 View alignment 2efd ( Chain: D, B) Ara7/atvps9a PDB_Info PDB_Structure Arabidopsis thaliana Chain D = 7.6e-26 43 32 View alignment SCOP MMDB CATH Chain B = 7.6e-26 43 32 View alignment 1z06 ( Chain: A) Gppnhp-bound rab33 gtpase PDB_Info PDB_Structure Mus musculus 8.2e-26 42 33 View alignment SCOP MMDB CATH 1z08 ( Chain: C, A, D, B) Gppnhp-bound rab21 q53g mutant gtpase PDB_Info PDB_Structure Homo sapiens Chain C = 1.4e-25 43 31 View alignment SCOP MMDB CATH Chain A = 1.4e-25 43 31 View alignment Chain D = 1.4e-25 43 31 View alignment Chain B = 1.4e-25 43 31 View alignment 1ky3 ( Chain: A) Gdp-bound ypt7p at 1.35 a resolution PDB_Info PDB_Structure Saccharomyces cerevisiae 2.8e-25 44 27 View alignment SCOP MMDB CATH 1ky2 ( Chain: A) Gppnhp-bound ypt7p at 1.6 a resolution PDB_Info PDB_Structure Saccharomyces cerevisiae 2.8e-25 44 27 View alignment SCOP MMDB CATH 1yvd ( Chain: A) Gppnhp-bound rab22 gtpase PDB_Info PDB_Structure Mus musculus 3.7e-25 42 31 View alignment SCOP MMDB CATH 2e9s ( Chain: C, A, B) Human neuronal rab6b in three intermediate forms PDB_Info PDB_Structure Homo sapiens Chain C = 7.2e-25 41 35 View alignment SCOP MMDB CATH Chain A = 7.2e-25 41 35 View alignment Chain B = 7.2e-25 41 35 View alignment 2ffq ( Chain: A) The crystal structure of human neuronal rab6b in its active gtpgs-bound form PDB_Info PDB_Structure Homo sapiens 7.2e-25 41 35 View alignment SCOP MMDB CATH 2fe4 ( Chain: A) The crystal structure of human neuronal rab6b in its inactive gdp-bound form PDB_Info PDB_Structure Homo sapiens 7.2e-25 41 35 View alignment SCOP MMDB CATH 1z0i ( Chain: A) Gdp-bound rab21 gtpase PDB_Info PDB_Structure Homo sapiens 7.2e-25 42 32 View alignment SCOP MMDB CATH 2ot3 ( Chain: B) Crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21 PDB_Info PDB_Structure Homo sapiens 7.2e-25 42 32 View alignment SCOP MMDB CATH 1yzu ( Chain: B, A) Gppnhp-bound rab21 gtpase at 2.50 a resolution PDB_Info PDB_Structure Homo sapiens Chain B = 7.2e-25 42 32 View alignment SCOP MMDB CATH Chain A = 7.2e-25 42 32 View alignment 1yzt ( Chain: B, A) Gppnhp-bound rab21 gtpase at 2.05 a resolution PDB_Info PDB_Structure Homo sapiens Chain B = 8.0e-25 42 32 View alignment SCOP MMDB CATH Chain A = 8.0e-25 42 32 View alignment 1z0j ( Chain: A) Structure of gtp-bound rab22q64l gtpase in complex with the minimal rab binding domain of rabenosyn-5 PDB_Info PDB_Structure Mus musculus | Homo sapiens 1.1e-24 41 32 View alignment SCOP MMDB CATH 1yzq ( Chain: A) Gppnhp-bound rab6 gtpase PDB_Info PDB_Structure Homo sapiens 1.9e-24 41 35 View alignment SCOP MMDB CATH 2gil ( Chain: C, B, D, A) Structure of the extremely slow gtpase rab6a in the gtp bound form at 1.8 resolution PDB_Info PDB_Structure Homo sapiens Chain C = 3.0e-24 41 34 View alignment SCOP MMDB CATH Chain B = 3.0e-24 41 34 View alignment Chain D = 3.0e-24 41 34 View alignment Chain A = 3.0e-24 41 34 View alignment 1ek0 ( Chain: A) Gppnhp-bound ypt51 at 1.48 a resolution PDB_Info PDB_Structure Saccharomyces cerevisiae 7.3e-24 41 31 View alignment SCOP MMDB CATH 2ocb ( Chain: A) Crystal structure of human rab9b in complex with a gtp analogue PDB_Info PDB_Structure Homo sapiens 9.4e-24 40 33 View alignment SCOP MMDB CATH 1yzl ( Chain: A) Gppnhp-bound rab9 gtpase PDB_Info PDB_Structure Mus musculus 1.3e-23 40 34 View alignment SCOP MMDB CATH 3cwz ( Chain: A) Strucure of rab6(gtp)-r6ip1 complex PDB_Info PDB_Structure Homo sapiens | Mus musculus 1.6e-23 41 34 View alignment SCOP MMDB CATH 3bbp ( Chain: A, B, C) Rab6-gtp:gcc185 rab binding domain complex PDB_Info PDB_Structure Homo sapiens Chain A = 1.8e-23 41 34 View alignment SCOP MMDB CATH Chain B = 1.8e-23 41 34 View alignment Chain C = 1.8e-23 41 34 View alignment 1huq ( Chain: A) .8a crystal structure of the monomeric gtpase rab5c (mouse) PDB_Info PDB_Structure Mus musculus 1.8e-23 42 35 View alignment SCOP MMDB CATH 1n6h ( Chain: A) Crystal structure of human rab5a PDB_Info PDB_Structure Homo sapiens 2.3e-23 42 36 View alignment SCOP MMDB CATH 1r2q ( Chain: A) Crystal structure of human rab5a gtpase domain at 1.05 a resolution PDB_Info PDB_Structure Homo sapiens 2.3e-23 42 36 View alignment SCOP MMDB CATH 1tu3 ( Chain: E, D, C, B, A) Crystal structure of rab5 complex with rabaptin5 c-terminal domain PDB_Info PDB_Structure Homo sapiens Chain E = 2.3e-23 42 36 View alignment SCOP MMDB CATH Chain D = 2.3e-23 42 36 View alignment Chain C = 2.3e-23 42 36 View alignment Chain B = 2.3e-23 42 36 View alignment Chain A = 2.3e-23 42 36 View alignment 1tu4 ( Chain: C, D, B, A) Crystal structure of rab5-gdp complex PDB_Info PDB_Structure Homo sapiens Chain C = 2.3e-23 42 36 View alignment SCOP MMDB CATH Chain D = 2.3e-23 42 36 View alignment Chain B = 2.3e-23 42 36 View alignment Chain A = 2.3e-23 42 36 View alignment 1n6i ( Chain: A) Crystal structure of human rab5a a30p mutant complex with gdp PDB_Info PDB_Structure Homo sapiens 3.2e-23 42 35 View alignment SCOP MMDB CATH 1n6o ( Chain: A) Crystal structure of human rab5a a30k mutant complex with gppnhp PDB_Info PDB_Structure Homo sapiens 3.2e-23 42 35 View alignment SCOP MMDB CATH 1n6k ( Chain: A) Crystal structure of human rab5a a30p mutant complex with gdp and aluminum fluoride PDB_Info PDB_Structure Homo sapiens 3.2e-23 42 35 View alignment SCOP MMDB CATH 1n6l ( Chain: A) Crystal structure of human rab5a a30p mutant complex with gtp PDB_Info PDB_Structure Homo sapiens 3.2e-23 42 35 View alignment SCOP MMDB CATH 2hei ( Chain: A, B) Crystal structure of human rab5b in complex with gdp PDB_Info PDB_Structure Homo sapiens Chain A = 3.4e-23 39 36 View alignment SCOP MMDB CATH Chain B = 3.4e-23 39 36 View alignment 2fg5 ( Chain: A) Crystal structure of human rab31 in complex with a gtp analogue PDB_Info PDB_Structure Homo sapiens 3.8e-23 39 33 View alignment SCOP MMDB CATH 1n6p ( Chain: A) Crystal structure of human rab5a a30e mutant complex with gppnhp PDB_Info PDB_Structure Homo sapiens 3.9e-23 42 35 View alignment SCOP MMDB CATH 1n6n ( Chain: A) Crystal structure of human rab5a a30r mutant complex with gppnhp PDB_Info PDB_Structure Homo sapiens 3.9e-23 42 35 View alignment SCOP MMDB CATH 1n6r ( Chain: A) Crystal structure of human rab5a a30l mutant complex with gppnhp PDB_Info PDB_Structure Homo sapiens 4.6e-23 42 35 View alignment SCOP MMDB CATH 1z0d ( Chain: A, C) Gdp-bound rab5c gtpase PDB_Info PDB_Structure Mus musculus Chain A = 8.7e-23 42 34 View alignment SCOP MMDB CATH Chain C = 8.7e-23 42 34 View alignment 1z07 ( Chain: A) Gppnhp-bound rab5c g55q mutant gtpase PDB_Info PDB_Structure Mus musculus 9.9e-23 42 34 View alignment SCOP MMDB CATH 1s8f ( Chain: B, A) Crystal structure of rab9 complexed to gdp reveals a dimer with an active conformation of switch ii PDB_Info PDB_Structure Canis lupus familiaris Chain B = 1.0e-22 39 33 View alignment SCOP MMDB CATH Chain A = 1.0e-22 39 33 View alignment 1wms ( Chain: B, A) High resolution crystal structure of human rab9 gtpase: a novel antiviral drug target PDB_Info PDB_Structure Homo sapiens Chain B = 1.0e-22 39 33 View alignment SCOP MMDB CATH Chain A = 1.0e-22 39 33 View alignment 1d5c ( Chain: A) Crystal structure of plasmodium falciparum rab6 complexed with gdp PDB_Info PDB_Structure Plasmodium falciparum 4.4e-22 41 33 View alignment SCOP MMDB CATH 1vg9 ( Chain: B, F, H, D) The crystal structures of the rep-1 protein in complex with c-terminally truncated rab7 protein PDB_Info PDB_Structure Rattus norvegicus Chain B = 3.8e-21 39 33 View alignment SCOP MMDB CATH Chain F = 3.8e-21 39 33 View alignment Chain H = 3.8e-21 39 33 View alignment Chain D = 3.8e-21 39 33 View alignment 1vg1 ( Chain: A) Gdp-bound rab7 PDB_Info PDB_Structure Rattus norvegicus 3.8e-21 39 33 View alignment SCOP MMDB CATH 1vg8 ( Chain: A, C, D, B) Gppnhp-bound rab7 PDB_Info PDB_Structure Rattus norvegicus Chain A = 4.2e-21 39 33 View alignment SCOP MMDB CATH Chain C = 4.2e-21 39 33 View alignment Chain D = 4.2e-21 39 33 View alignment Chain B = 4.2e-21 39 33 View alignment 1vg0 ( Chain: B) The crystal structures of the rep-1 protein in complex with monoprenylated rab7 protein PDB_Info PDB_Structure Rattus norvegicus 4.2e-21 39 33 View alignment SCOP MMDB CATH 1z2a ( Chain: A) Gdp-bound rab23 gtpase crystallized in p2(1)2(1)2(1) space group PDB_Info PDB_Structure Mus musculus 4.6e-21 39 35 View alignment SCOP MMDB CATH 1z22 ( Chain: A) Gdp-bound rab23 gtpase crystallized in c222(1) space group PDB_Info PDB_Structure Mus musculus 4.6e-21 39 35 View alignment SCOP MMDB CATH 1t91 ( Chain: D, C, B, A) Crystal structure of human small gtpase rab7(gtp) PDB_Info PDB_Structure Homo sapiens Chain D = 1.8e-20 38 33 View alignment SCOP MMDB CATH Chain C = 1.8e-20 38 33 View alignment Chain B = 1.8e-20 38 33 View alignment Chain A = 1.8e-20 38 33 View alignment 1yhn ( Chain: A) Structure basis of rilp recruitment by rab7 PDB_Info PDB_Structure Homo sapiens 1.8e-20 38 33 View alignment SCOP MMDB CATH 2cld ( Chain: X) Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp (2) PDB_Info PDB_Structure Homo sapiens 1.7e-18 34 41 View alignment SCOP MMDB CATH 2ke5 ( Chain: A) Solution structure and dynamics of the small gtpase ralb in its active conformation: significance for effector protein binding PDB_Info PDB_Structure Homo sapiens 2.2e-18 33 41 View alignment SCOP MMDB CATH 2c5l ( Chain: B, A) Structure of plc epsilon ras association domain with hras PDB_Info PDB_Structure Homo sapiens Chain B = 2.6e-18 33 40 View alignment SCOP MMDB CATH Chain A = 2.6e-18 33 40 View alignment 2bov ( Chain: A) Molecular recognition of an adp-ribosylating clostridium botulinum c3 exoenzyme by rala gtpase PDB_Info PDB_Structure Homo sapiens | Clostridium botulinum 2.7e-18 30 40 View alignment SCOP MMDB CATH 3con ( Chain: A) Crystal structure of the human nras gtpase bound with gdp PDB_Info PDB_Structure Homo sapiens 2.8e-18 35 37 View alignment SCOP MMDB CATH 1lfd ( Chain: D, B) Crystal structure of the active ras protein complexed with the ras-interacting domain of ralgds PDB_Info PDB_Structure Rattus norvegicus | Homo sapiens Chain D = 4.0e-18 33 42 View alignment SCOP MMDB CATH Chain B = 4.0e-18 33 42 View alignment 3ddc ( Chain: A) Crystal structure of nore1a in complex with ras PDB_Info PDB_Structure Homo sapiens | Mus musculus 4.0e-18 33 42 View alignment SCOP MMDB CATH 2cl7 ( Chain: X) Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gtp PDB_Info PDB_Structure Homo sapiens 4.7e-18 34 40 View alignment SCOP MMDB CATH 2cl6 ( Chain: X) Crystal structure analysis of a fluorescent form of h-ras p21 in complex with s-caged gtp PDB_Info PDB_Structure Homo sapiens 4.7e-18 34 40 View alignment SCOP MMDB CATH 2cl0 ( Chain: X) Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gppnhp PDB_Info PDB_Structure Homo sapiens 4.7e-18 34 40 View alignment SCOP MMDB CATH 1nvw ( Chain: Q, R) Structural evidence for feedback activation by rasgtp of the ras-specific nucleotide exchange factor sos PDB_Info PDB_Structure Homo sapiens Chain Q = 4.7e-18 33 41 View alignment SCOP MMDB CATH Chain R = 4.7e-18 33 41 View alignment 1crp ( Chain: A) The solution structure and dynamics of ras p21. gdp determined by heteronuclear three and four dimensional nmr spectroscopy PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1p2v ( Chain: A) H-ras 166 in 60 % 1,6 hexanediol PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1nvv ( Chain: R, Q) Structural evidence for feedback activation by rasgtp of the ras-specific nucleotide exchange factor sos PDB_Info PDB_Structure Homo sapiens Chain R = 4.7e-18 33 41 View alignment SCOP MMDB CATH Chain Q = 1.5e-17 33 41 View alignment 1k8r ( Chain: A) Crystal structure of ras-bry2rbd complex PDB_Info PDB_Structure Homo sapiens | Schizosaccharomyces pombe 4.7e-18 33 41 View alignment SCOP MMDB CATH 1qra ( Chain: A) Structure of p21ras in complex with gtp at 100 k PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1xd2 ( Chain: B, A) Crystal structure of a ternary ras:sos:ras*gdp complex PDB_Info PDB_Structure Homo sapiens Chain B = 4.7e-18 33 41 View alignment SCOP MMDB CATH Chain A = 1.5e-17 33 41 View alignment 1gnp ( Chain: A) X-ray crystal structure analysis of the catalytic domain of the oncogene product p21h-ras complexed with caged gtp and mant dgppnhp PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1ctq ( Chain: A) Structure of p21ras in complex with gppnhp at 100 k PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1crr ( Chain: A) The solution structure and dynamics of ras p21. gdp determined by heteronuclear three and four dimensional nmr spectroscopy PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1p2t ( Chain: A) H-ras 166 in aqueous mother liqour, rt PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1bkd ( Chain: R) Complex of human h-ras with human sos-1 PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1gnq ( Chain: A) X-ray crystal structure analysis of the catalytic domain of the oncogene product p21h-ras complexed with caged gtp and mant dgppnhp PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1p2s ( Chain: A) H-ras 166 in 50% 2,2,2 triflouroethanol PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1agp ( Chain: A) Three-dimensional structures and properties of a transforming and a nontransforming gly-12 mutant of p21-h- ras PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1wq1 ( Chain: R) Ras-rasgap complex PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1p2u ( Chain: A) H-ras in 50% isopropanol PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 121p ( Chain: A) Struktur und guanosintriphosphat-hydrolysemechanismus des c- terminal verkuerzten menschlichen krebsproteins p21-h-ras PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1gnr ( Chain: A) X-ray crystal structure analysis of the catalytic domain of the oncogene product p21h-ras complexed with caged gtp and mant dgppnhp PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 5p21 ( Chain: A) Refined crystal structure of the triphosphate conformation of h-ras p21 at 1.35 angstroms resolution: implications for the mechanism of gtp hydrolysis PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 2rge ( Chain: A) Crystal structure of h-ras-gppnhp PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 1crq ( Chain: A) The solution structure and dynamics of ras p21. gdp determined by heteronuclear three and four dimensional nmr spectroscopy PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 221p ( Chain: A) Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules PDB_Info PDB_Structure Homo sapiens 4.7e-18 33 41 View alignment SCOP MMDB CATH 2evw ( Chain: X) Crystal structure analysis of a fluorescent form of h-ras p21 in complex with r-caged gtp PDB_Info PDB_Structure Homo sapiens 4.7e-18 34 40 View alignment SCOP MMDB CATH 2ce2 ( Chain: X) Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp PDB_Info PDB_Structure Homo sapiens 4.7e-18 34 40 View alignment SCOP MMDB CATH 2clc ( Chain: X) Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gtp (2) PDB_Info PDB_Structure Homo sapiens 4.7e-18 34 40 View alignment SCOP MMDB CATH 1aa9 ( Chain: A) Human c-ha-ras(1-171)(dot)gdp, nmr, minimized average structure PDB_Info PDB_Structure Homo sapiens 5.0e-18 33 41 View alignment SCOP MMDB CATH 6q21 ( Chain: D, C, B, A) Molecular switch for signal transduction: structural differences between active and inactive forms of protooncogenic ras proteins PDB_Info PDB_Structure Homo sapiens Chain D = 5.0e-18 33 41 View alignment SCOP MMDB CATH Chain C = 5.0e-18 33 41 View alignment Chain B = 5.0e-18 33 41 View alignment Chain A = 5.0e-18 33 41 View alignment 1ioz ( Chain: A) Crystal structure of the c-ha-ras protein prepared by the cell-free synthesis PDB_Info PDB_Structure Homo sapiens 5.0e-18 33 41 View alignment SCOP MMDB CATH 1q21 ( Chain: A) Crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp PDB_Info PDB_Structure Homo sapiens 5.0e-18 33 41 View alignment SCOP MMDB CATH 1plj ( Chain: A) Crystallographic studies on p21h-ras using synchrotron laue method: improvement of crystal quality and monitoring of the gtpase reaction at different time points PDB_Info PDB_Structure Homo sapiens 5.7e-18 33 41 View alignment SCOP MMDB CATH 4q21 ( Chain: A) Molecular switch for signal transduction: structural differences between active and inactive forms of protooncogenic ras proteins PDB_Info PDB_Structure Homo sapiens 5.7e-18 33 41 View alignment SCOP MMDB CATH 1jai ( Chain: A) H-ras p21 protein mutant g12p, complexed with guanosine-5'- [beta,gamma-methylene] triphosphate and manganese PDB_Info PDB_Structure Homo sapiens 5.7e-18 33 41 View alignment SCOP MMDB CATH 421p ( Chain: A) Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules PDB_Info PDB_Structure Homo sapiens 5.7e-18 33 41 View alignment SCOP MMDB CATH 1pll ( Chain: A) Crystallographic studies on p21h-ras using synchrotron laue method: improvement of crystal quality and monitoring of the gtpase reaction at different time points PDB_Info PDB_Structure Homo sapiens 5.7e-18 33 41 View alignment SCOP MMDB CATH 821p ( Chain: A) Three-dimensional structures and properties of a transforming and a nontransforming glycine-12 mutant of p21h-ras PDB_Info PDB_Structure Homo sapiens 5.7e-18 33 41 View alignment SCOP MMDB CATH 1clu ( Chain: A) H-ras complexed with diaminobenzophenone-beta,gamma-imido- gtp PDB_Info PDB_Structure Homo sapiens 5.7e-18 33 41 View alignment SCOP MMDB CATH 2a9k ( Chain: A) Crystal structure of the c3bot-nad-rala complex reveals a novel type of action of a bacterial exoenzyme PDB_Info PDB_Structure Homo sapiens | Clostridium botulinum d phage 6.6e-18 33 40 View alignment SCOP MMDB CATH 2a78 ( Chain: A) Crystal structure of the c3bot-rala complex reveals a novel type of action of a bacterial exoenzyme PDB_Info PDB_Structure Homo sapiens | Clostridium botulinum d phage 6.6e-18 33 40 View alignment SCOP MMDB CATH 2uzi ( Chain: R) Crystal structure of hras(g12v) - anti-ras fv complex PDB_Info PDB_Structure Homo sapiens 6.7e-18 33 41 View alignment SCOP MMDB CATH 1rvd ( Chain: A) H-ras complexed with diaminobenzophenone-beta,gamma-imido- gtp PDB_Info PDB_Structure Homo sapiens 6.7e-18 33 41 View alignment SCOP MMDB CATH 1he8 ( Chain: B) Ras g12v - pi 3-kinase gamma complex PDB_Info PDB_Structure Homo sapiens 6.7e-18 33 41 View alignment SCOP MMDB CATH 2vh5 ( Chain: R) Crystal structure of hras(g12v) - anti-ras fv (disulfide free mutant) complex PDB_Info PDB_Structure Homo sapiens 6.7e-18 33 41 View alignment SCOP MMDB CATH 2q21 ( Chain: A) Crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp PDB_Info PDB_Structure Homo sapiens 6.9e-18 33 41 View alignment SCOP MMDB CATH 1iaq ( Chain: C, B, A) C-h-ras p21 protein mutant with thr 35 replaced by ser (t35s) complexed with guanosine-5'-[b,g-imido] triphosphate PDB_Info PDB_Structure Homo sapiens Chain C = 7.8e-18 33 41 View alignment SCOP MMDB CATH Chain B = 7.8e-18 33 41 View alignment Chain A = 7.8e-18 33 41 View alignment 1jah ( Chain: A) H-ras p21 protein mutant g12p, complexed with guanosine-5'- [beta,gamma-methylene] triphosphate and magnesium PDB_Info PDB_Structure Homo sapiens 7.8e-18 33 40 View alignment SCOP MMDB CATH 2quz ( Chain: A) Crystal structure of the activating h-rask117r mutant in costello syndrome, bound to mg-gdp PDB_Info PDB_Structure Homo sapiens 7.8e-18 33 41 View alignment SCOP MMDB CATH 1plk ( Chain: A) Crystallographic studies on p21h-ras using synchrotron laue method: improvement of crystal quality and monitoring of the gtpase reaction at different time points PDB_Info PDB_Structure Homo sapiens 7.8e-18 33 40 View alignment SCOP MMDB CATH 1x1s ( Chain: A) Crystal structure of m-ras in complex with gppnhp PDB_Info PDB_Structure Mus musculus 8.5e-18 36 36 View alignment SCOP MMDB CATH 1x1r ( Chain: A) Crystal structure of m-ras in complex with gdp PDB_Info PDB_Structure Mus musculus 8.5e-18 36 36 View alignment SCOP MMDB CATH 1nvx ( Chain: R, Q) Structural evidence for feedback activation by rasgtp of the ras-specific nucleotide exchange factor sos PDB_Info PDB_Structure Homo sapiens Chain R = 1.0e-17 33 41 View alignment SCOP MMDB CATH Chain Q = 1.0e-17 33 41 View alignment 1nvu ( Chain: R, Q) Structural evidence for feedback activation by rasgtp of the ras-specific nucleotide exchange factor sos PDB_Info PDB_Structure Homo sapiens Chain R = 1.0e-17 33 41 View alignment SCOP MMDB CATH Chain Q = 1.0e-17 33 41 View alignment 1lf0 ( Chain: A) Crystal structure of rasa59g in the gtp-bound form PDB_Info PDB_Structure Homo sapiens 1.0e-17 33 41 View alignment SCOP MMDB CATH 2rgb ( Chain: A) Crystal structure of h-rasq61k-gppnhp PDB_Info PDB_Structure Homo sapiens 1.0e-17 33 41 View alignment SCOP MMDB CATH 1lf5 ( Chain: A) Crystal structure of rasa59g in the gdp-bound form PDB_Info PDB_Structure Homo sapiens 1.0e-17 33 41 View alignment SCOP MMDB CATH 621p ( Chain: A) Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules PDB_Info PDB_Structure Homo sapiens 1.2e-17 33 41 View alignment SCOP MMDB CATH 3cf6 ( Chain: R) Structure of epac2 in complex with cyclic-amp and rap PDB_Info PDB_Structure Mus musculus | Homo sapiens 1.5e-17 37 36 View alignment SCOP MMDB CATH 3brw ( Chain: D) Structure of the rap-rapgap complex PDB_Info PDB_Structure Homo sapiens 1.5e-17 37 36 View alignment SCOP MMDB CATH 521p ( Chain: A) Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules PDB_Info PDB_Structure Homo sapiens 1.5e-17 33 41 View alignment SCOP MMDB CATH 1xcm ( Chain: A) Crystal structure of the gppnhp-bound h-ras g60a mutant PDB_Info PDB_Structure Homo sapiens 1.8e-17 33 41 View alignment SCOP MMDB CATH 1xj0 ( Chain: A) Crystal structure of the gdp-bound form of the rasg60a mutant PDB_Info PDB_Structure Homo sapiens 1.8e-17 33 41 View alignment SCOP MMDB CATH 721p ( Chain: A) Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules PDB_Info PDB_Structure Homo sapiens 2.1e-17 33 41 View alignment SCOP MMDB CATH 2rgd ( Chain: A) Crystal structure of h-rasq61l-gppnhp PDB_Info PDB_Structure Homo sapiens 2.1e-17 33 41 View alignment SCOP MMDB CATH 1zw6 ( Chain: A) Crystal structure of the gtp-bound form of rasq61g PDB_Info PDB_Structure Homo sapiens 2.1e-17 33 41 View alignment SCOP MMDB CATH 1zvq ( Chain: A) Structure of the q61g mutant of ras in the gdp-bound form PDB_Info PDB_Structure Homo sapiens 2.1e-17 33 41 View alignment SCOP MMDB CATH 2rga ( Chain: A) Crystal structure of h-rasq61i-gppnhp PDB_Info PDB_Structure Homo sapiens 2.4e-17 33 41 View alignment SCOP MMDB CATH 2rap ( Chain: A) The small g protein rap2a in complex with gtp PDB_Info PDB_Structure Homo sapiens 2.4e-17 36 36 View alignment SCOP MMDB CATH 1kao ( Chain: A) Crystal structure of the small g protein rap2a with gdp PDB_Info PDB_Structure Homo sapiens 2.4e-17 36 36 View alignment SCOP MMDB CATH 3rap ( Chain: R, S) The small g protein rap2 in a non catalytic complex with gtp PDB_Info PDB_Structure Homo sapiens Chain R = 2.4e-17 36 36 View alignment SCOP MMDB CATH Chain S = 2.4e-17 36 36 View alignment 2rgc ( Chain: A) Crystal structure of h-rasq61v-gppnhp PDB_Info PDB_Structure Homo sapiens 2.4e-17 33 41 View alignment SCOP MMDB CATH 2rgg ( Chain: A) Crystal structure of h-rasq61i-gppnhp, trigonal crystal form PDB_Info PDB_Structure Homo sapiens 2.4e-17 33 41 View alignment SCOP MMDB CATH 3gft ( Chain: B, E, C, F, A, D) Human k-ras in complex with a gtp analogue PDB_Info PDB_Structure Homo sapiens Chain B = 2.9e-17 33 38 View alignment SCOP MMDB CATH Chain E = 2.9e-17 33 38 View alignment Chain C = 2.9e-17 33 38 View alignment Chain F = 2.9e-17 33 38 View alignment Chain A = 2.9e-17 33 38 View alignment Chain D = 2.9e-17 33 38 View alignment 1c1y ( Chain: A) Crystal structure of rap.gmppnp in complex with the ras- binding-domain of c-raf1 kinase (rafrbd). PDB_Info PDB_Structure Homo sapiens 6.9e-17 37 34 View alignment SCOP MMDB CATH 1uad ( Chain: B, A) Crystal structure of the rala-gppnhp-sec5 ral-binding domain complex PDB_Info PDB_Structure Homo sapiens | Rattus norvegicus Chain B = 7.3e-17 32 42 View alignment SCOP MMDB CATH Chain A = 7.3e-17 32 42 View alignment 2j0v ( Chain: A, D, B, C) The crystal structure of arabidopsis thaliana rac7-rop9: the first ras superfamily gtpase from the plant kingdom PDB_Info PDB_Structure Arabidopsis thaliana Chain A = 7.7e-17 33 34 View alignment SCOP MMDB CATH Chain D = 7.7e-17 33 34 View alignment Chain B = 7.7e-17 33 34 View alignment Chain C = 7.7e-17 33 34 View alignment 1gua ( Chain: A) Human rap1a, residues 1-167, double mutant (e30d,k31e) complexed with gppnhp and the ras-binding-domain of human c-raf1, residues 51-131 PDB_Info PDB_Structure Homo sapiens 8.1e-17 37 33 View alignment SCOP MMDB CATH 1u8z ( Chain: B, A) Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap PDB_Info PDB_Structure Saguinus oedipus Chain B = 9.6e-17 32 41 View alignment SCOP MMDB CATH Chain A = 9.6e-17 32 41 View alignment 1u90 ( Chain: A, B) Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap PDB_Info PDB_Structure Saguinus oedipus Chain A = 9.6e-17 32 41 View alignment SCOP MMDB CATH Chain B = 9.6e-17 32 41 View alignment 1u8y ( Chain: A, B) Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap PDB_Info PDB_Structure Saguinus oedipus Chain A = 9.6e-17 32 41 View alignment SCOP MMDB CATH Chain B = 9.6e-17 32 41 View alignment 2ery ( Chain: B, A) The crystal structure of the ras related protein rras2 (rras2) in the gdp bound state PDB_Info PDB_Structure Homo sapiens Chain B = 1.8e-16 33 37 View alignment SCOP MMDB CATH Chain A = 1.8e-16 33 37 View alignment 1zc4 ( Chain: C, A) Crystal structure of the ral-binding domain of exo84 in complex with the active rala PDB_Info PDB_Structure Homo sapiens | Rattus norvegicus Chain C = 3.2e-16 31 42 View alignment SCOP MMDB CATH Chain A = 3.2e-16 31 42 View alignment 1zc3 ( Chain: A, C) Crystal structure of the ral-binding domain of exo84 in complex with the active rala PDB_Info PDB_Structure Homo sapiens | Rattus norvegicus Chain A = 3.2e-16 31 42 View alignment SCOP MMDB CATH Chain C = 3.2e-16 31 42 View alignment 3e5h ( Chain: A) Crystal structure of rab28 gtpase in the active (gppnhp- bound) form PDB_Info PDB_Structure Homo sapiens 1.5e-15 33 32 View alignment SCOP MMDB CATH 2hxs ( Chain: A) Crystal structure of rab28a gtpase in the inactive (gdp-3'p- bound) form PDB_Info PDB_Structure Homo sapiens 1.5e-15 33 32 View alignment SCOP MMDB CATH 1xtr ( Chain: A) Structure of small gtpase human rheb in complex with gppnhp PDB_Info PDB_Structure Homo sapiens 3.2e-15 37 29 View alignment SCOP MMDB CATH 1xts ( Chain: A) Structure of small gtpase human rheb in complex with gtp PDB_Info PDB_Structure Homo sapiens 3.2e-15 37 29 View alignment SCOP MMDB CATH 1xtq ( Chain: A) Structure of small gtpase human rheb in complex with gdp PDB_Info PDB_Structure Homo sapiens 3.2e-15 37 29 View alignment SCOP MMDB CATH 2nty ( Chain: D, C) Rop4-gdp-prone8 PDB_Info PDB_Structure Arabidopsis thaliana Chain D = 4.0e-15 31 34 View alignment SCOP MMDB CATH Chain C = 4.0e-15 31 34 View alignment 3bwd ( Chain: D) Crystal structure of the plant rho protein rop5 PDB_Info PDB_Structure Arabidopsis thaliana 4.0e-15 33 31 View alignment SCOP MMDB CATH 2fn4 ( Chain: A) The crystal structure of human ras-related protein, rras, in the gdp-bound state PDB_Info PDB_Structure Homo sapiens 2.9e-14 31 38 View alignment SCOP MMDB CATH 3gj0 ( Chain: A, B) GTP-binding nuclear pro PDB_Info PDB_Structure Unknown Chain A = 3.8e-14 30 38 View alignment SCOP MMDB CATH Chain B = 3.8e-14 30 38 View alignment 3gj3 ( Chain: A) GTP-binding nuclear pro PDB_Info PDB_Structure Unknown 3.8e-14 30 38 View alignment SCOP MMDB CATH 2j1l ( Chain: A) Crystal structure of human rho-related gtp-binding protein rhod PDB_Info PDB_Structure Homo sapiens 4.2e-14 31 32 View alignment SCOP MMDB CATH 1wa5 ( Chain: A) Crystal structure of the exportin cse1p complexed with its cargo (kap60p) and rangtp PDB_Info PDB_Structure Canis familiaris | Saccharomyces cerevisiae 4.6e-14 31 38 View alignment SCOP MMDB CATH 1rrp ( Chain: A, C) Structure of the ran-gppnhp-ranbd1 complex PDB_Info PDB_Structure Homo sapiens Chain A = 5.6e-14 31 38 View alignment SCOP MMDB CATH Chain C = 5.6e-14 31 38 View alignment 2bku ( Chain: A, C) Kap95p:rangtp complex PDB_Info PDB_Structure Canis familiaris | Saccharomyces cerevisiae Chain A = 5.6e-14 31 37 View alignment SCOP MMDB CATH Chain C = 5.6e-14 31 37 View alignment 1a2k ( Chain: D, E, C) Gdpran-ntf2 complex PDB_Info PDB_Structure Rattus norvegicus | Canis lupus familiaris Chain D = 6.0e-14 31 38 View alignment SCOP MMDB CATH Chain E = 6.0e-14 31 38 View alignment Chain C = 6.0e-14 31 38 View alignment 1k5g ( Chain: D, G, A, J) Crystal structure of ran-gdp-alfx-ranbp1-rangap complex PDB_Info PDB_Structure Homo sapiens | Schizosaccharomyces pombe Chain D = 6.0e-14 31 38 View alignment SCOP MMDB CATH Chain G = 6.0e-14 31 38 View alignment Chain A = 6.0e-14 31 38 View alignment Chain J = 6.0e-14 31 38 View alignment 1k5d ( Chain: G, J, D, A) Crystal structure of ran-gppnhp-ranbp1-rangap complex PDB_Info PDB_Structure Homo sapiens | Schizosaccharomyces pombe Chain G = 6.0e-14 31 38 View alignment SCOP MMDB CATH Chain J = 6.0e-14 31 38 View alignment Chain D = 6.0e-14 31 38 View alignment Chain A = 6.0e-14 31 38 View alignment 1i2m ( Chain: C, A) Ran-rcc1-so4 complex PDB_Info PDB_Structure Homo sapiens Chain C = 6.0e-14 31 38 View alignment SCOP MMDB CATH Chain A = 6.0e-14 31 38 View alignment 3ea5 ( Chain: C, A) Kap95p binding induces the switch loops of rangdp to adopt the gtp-bound conformation: implications for nuclear import complex assembly dynamics PDB_Info PDB_Structure Homo sapiens | Saccharomyces cerevisiae Chain C = 6.0e-14 31 38 View alignment SCOP MMDB CATH Chain A = 6.0e-14 31 38 View alignment 3ch5 ( Chain: A) The crystal structure of the rangdp-nup153znf2 complex PDB_Info PDB_Structure Homo sapiens | Rattus norvegicus 6.0e-14 31 38 View alignment SCOP MMDB CATH 1qg2 ( Chain: A) Canine gdp-ran r76e mutant PDB_Info PDB_Structure Canis lupus familiaris 6.0e-14 31 38 View alignment SCOP MMDB CATH 1ibr ( Chain: C, A) Complex of ran with importin beta PDB_Info PDB_Structure Homo sapiens Chain C = 6.0e-14 31 38 View alignment SCOP MMDB CATH Chain A = 6.0e-14 31 38 View alignment 1qbk ( Chain: C) Structure of the karyopherin beta2-ran gppnhp nuclear transport complex PDB_Info PDB_Structure Homo sapiens 6.0e-14 31 38 View alignment SCOP MMDB CATH 1byu ( Chain: A, B) Canine gdp-ran PDB_Info PDB_Structure Canis lupus familiaris Chain A = 7.1e-14 31 37 View alignment SCOP MMDB CATH Chain B = 7.1e-14 31 37 View alignment 1s1c ( Chain: B, A) Crystal structure of the complex between the human rhoa and rho-binding domain of human rocki PDB_Info PDB_Structure Homo sapiens Chain B = 8.1e-14 30 34 View alignment SCOP MMDB CATH Chain A = 8.1e-14 30 34 View alignment 1lb1 ( Chain: H, F, B, D) Crystal structure of the dbl and pleckstrin homology domains of dbs in complex with rhoa PDB_Info PDB_Structure Mus musculus | Homo sapiens Chain H = 8.6e-14 30 34 View alignment SCOP MMDB CATH Chain F = 8.6e-14 30 34 View alignment Chain B = 8.6e-14 30 34 View alignment Chain D = 8.6e-14 30 34 View alignment 2atv ( Chain: A) The crystal structure of human rerg in the gdp bound state PDB_Info PDB_Structure Homo sapiens 8.8e-14 34 34 View alignment SCOP MMDB CATH 1x86 ( Chain: F, D, H, B) Crystal structure of the dh/ph domains of leukemia- associated rhogef in complex with rhoa PDB_Info PDB_Structure Homo sapiens Chain F = 8.8e-14 30 34 View alignment SCOP MMDB CATH Chain D = 8.8e-14 30 34 View alignment Chain H = 8.8e-14 30 34 View alignment Chain B = 8.8e-14 30 34 View alignment 2rgn ( Chain: F, C) Crystal structure of p63rhogef complex with galpha-q and rhoa PDB_Info PDB_Structure Mus musculus | Homo sapiens Chain F = 8.8e-14 30 34 View alignment SCOP MMDB CATH Chain C = 8.8e-14 30 34 View alignment 2wbl ( Chain: C, D) Three-dimensional structure of a binary rop-prone complex PDB_Info PDB_Structure Arabidopsis thaliana Chain C = 9.3e-14 30 35 View alignment SCOP MMDB CATH Chain D = 9.3e-14 30 35 View alignment 1cxz ( Chain: A) Crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1 PDB_Info PDB_Structure Homo sapiens 1.1e-13 30 33 View alignment SCOP MMDB CATH 1a2b ( Chain: A) Human rhoa complexed with gtp analogue PDB_Info PDB_Structure Homo sapiens 1.1e-13 30 33 View alignment SCOP MMDB CATH 1qg4 ( Chain: A, B) Canine gdp-ran f72y mutant PDB_Info PDB_Structure Canis lupus familiaris Chain A = 1.2e-13 30 39 View alignment SCOP MMDB CATH Chain B = 1.2e-13 30 39 View alignment 3icq ( Chain: C, B) GTP-binding nuclear pro PDB_Info PDB_Structure Unknown Chain C = 1.4e-13 30 39 View alignment SCOP MMDB CATH Chain B = 1.4e-13 30 39 View alignment 3gj6 ( Chain: A) GTP-binding nuclear pro PDB_Info PDB_Structure Unknown 2.2e-13 29 38 View alignment SCOP MMDB CATH 3gj7 ( Chain: A, C) GTP-binding nuclear pro PDB_Info PDB_Structure Unknown Chain A = 2.2e-13 29 38 View alignment SCOP MMDB CATH Chain C = 2.2e-13 29 38 View alignment 3gj8 ( Chain: A, C) GTP-binding nuclear pro PDB_Info PDB_Structure Unknown Chain A = 2.2e-13 29 38 View alignment SCOP MMDB CATH Chain C = 2.2e-13 29 38 View alignment 3gj4 ( Chain: A, C) GTP-binding nuclear pro PDB_Info PDB_Structure Unknown Chain A = 2.2e-13 29 38 View alignment SCOP MMDB CATH Chain C = 2.2e-13 29 38 View alignment 3gj5 ( Chain: C, A) GTP-binding nuclear pro PDB_Info PDB_Structure Unknown Chain C = 2.2e-13 29 38 View alignment SCOP MMDB CATH Chain A = 2.2e-13 29 38 View alignment 3ran ( Chain: C, A, B, D) Canine gdp-ran q69l mutant PDB_Info PDB_Structure Canis lupus familiaris Chain C = 2.7e-13 30 38 View alignment SCOP MMDB CATH Chain A = 2.7e-13 30 38 View alignment Chain B = 2.7e-13 30 38 View alignment Chain D = 2.7e-13 30 38 View alignment 3gjx ( Chain: F, C) GTP-binding nuclear pro PDB_Info PDB_Structure Unknown Chain F = 2.7e-13 30 38 View alignment SCOP MMDB CATH Chain C = 2.7e-13 30 38 View alignment 2fv8 ( Chain: A) The crystal structure of rhob in the gdp-bound state PDB_Info PDB_Structure Homo sapiens 2.9e-13 29 34 View alignment SCOP MMDB CATH 1dpf ( Chain: A) Crystal structure of a mg-free form of rhoa complexed with gdp PDB_Info PDB_Structure Homo sapiens 3.4e-13 30 32 View alignment SCOP MMDB CATH 2gco ( Chain: B, A) Crystal structure of the human rhoc-gppnhp complex PDB_Info PDB_Structure Homo sapiens Chain B = 5.5e-13 29 35 View alignment SCOP MMDB CATH Chain A = 5.5e-13 29 35 View alignment 2gcn ( Chain: A) Crystal structure of the human rhoc-gdp complex PDB_Info PDB_Structure Homo sapiens 5.5e-13 29 35 View alignment SCOP MMDB CATH 2gcp ( Chain: A) Crystal structure of the human rhoc-gsp complex PDB_Info PDB_Structure Mus musculus 5.5e-13 29 35 View alignment SCOP MMDB CATH 1xcg ( Chain: B, F) Crystal structure of human rhoa in complex with dh/ph fragment of pdzrhogef PDB_Info PDB_Structure Homo sapiens Chain B = 5.7e-13 29 34 View alignment SCOP MMDB CATH Chain F = 5.7e-13 29 34 View alignment 1tx4 ( Chain: B) Rho/rhogap/gdp(dot)alf4 complex PDB_Info PDB_Structure Homo sapiens 5.7e-13 29 34 View alignment SCOP MMDB CATH 3clv ( Chain: A) Crystal structure of rab5a from plasmodium falciparum, pfb0500c PDB_Info PDB_Structure Plasmodium falciparum 5.7e-13 31 25 View alignment SCOP MMDB CATH 1cc0 ( Chain: A, C) Crystal structure of the rhoa.gdp-rhogdi complex PDB_Info PDB_Structure Homo sapiens Chain A = 6.2e-13 29 34 View alignment SCOP MMDB CATH Chain C = 6.2e-13 29 34 View alignment 1ftn ( Chain: A) Crystal structure of the human rhoa/gdp complex PDB_Info PDB_Structure Homo sapiens 6.3e-13 29 34 View alignment SCOP MMDB CATH 1ow3 ( Chain: B) Crystal structure of rhoa.gdp.mgf3-in complex with rhogap PDB_Info PDB_Structure Homo sapiens 6.3e-13 29 34 View alignment SCOP MMDB CATH 1kmq ( Chain: A) Crystal structure of a constitutively activated rhoa mutant (q63l) PDB_Info PDB_Structure Homo sapiens 2.5e-12 29 33 View alignment SCOP MMDB CATH 1z2c ( Chain: A, C) Crystal structure of mdia1 gbd-fh3 in complex with rhoc- gmppnp PDB_Info PDB_Structure Homo sapiens | Mus musculus Chain A = 2.8e-12 28 34 View alignment SCOP MMDB CATH Chain C = 2.8e-12 28 34 View alignment 2erx ( Chain: A, B) Crystal structure of diras2 in complex with gdp and inorganic phosphate PDB_Info PDB_Structure Homo sapiens Chain A = 3.4e-12 31 35 View alignment SCOP MMDB CATH Chain B = 3.4e-12 31 35 View alignment 1m7b ( Chain: A) Crystal structure of rnd3/rhoe: functional implications PDB_Info PDB_Structure Homo sapiens 3.6e-12 28 35 View alignment SCOP MMDB CATH 2nz8 ( Chain: A) N-terminal dhph cassette of trio in complex with nucleotide- free rac1 PDB_Info PDB_Structure Homo sapiens 4.1e-12 30 33 View alignment SCOP MMDB CATH 3bji ( Chain: D, C) Structural basis of promiscuous guanine nucleotide exchange by the t-cell essential vav1 PDB_Info PDB_Structure Homo sapiens Chain D = 4.1e-12 30 33 View alignment SCOP MMDB CATH Chain C = 4.1e-12 30 33 View alignment 1foe ( Chain: F, D, B, H) Crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1 PDB_Info PDB_Structure Mus musculus | Homo sapiens Chain F = 4.1e-12 30 33 View alignment SCOP MMDB CATH Chain D = 4.1e-12 30 33 View alignment Chain B = 4.1e-12 30 33 View alignment Chain H = 4.1e-12 30 33 View alignment 1he1 ( Chain: D, C) Crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac PDB_Info PDB_Structure Pseudomonas aeruginosa | Homo sapiens Chain D = 4.1e-12 30 33 View alignment SCOP MMDB CATH Chain C = 4.1e-12 30 33 View alignment 2fju ( Chain: A) Activated rac1 bound to its effector phospholipase c beta 2 PDB_Info PDB_Structure Homo sapiens 4.1e-12 30 33 View alignment SCOP MMDB CATH 2vrw ( Chain: A) Critical structural role for the ph and c1 domains of the vav1 exchange factor PDB_Info PDB_Structure Homo sapiens | Mus musculus 4.3e-12 30 33 View alignment SCOP MMDB CATH 1i4l ( Chain: D) Crystal structure analysis of rac1-gdp in complex with arfaptin (p41) PDB_Info PDB_Structure Homo sapiens 4.5e-12 30 33 View alignment SCOP MMDB CATH 1i4d ( Chain: D) Crystal structure analysis of rac1-gdp complexed with arfaptin (p21) PDB_Info PDB_Structure Homo sapiens 4.5e-12 30 33 View alignment SCOP MMDB CATH 2gf0 ( Chain: A, C, D, B) The crystal structure of the human diras1 gtpase in the inactive gdp bound state PDB_Info PDB_Structure Homo sapiens Chain A = 4.8e-12 29 36 View alignment SCOP MMDB CATH Chain C = 4.8e-12 29 36 View alignment Chain D = 4.8e-12 29 36 View alignment Chain B = 4.8e-12 29 36 View alignment 2h7v ( Chain: A, B) Co-crystal structure of ypka-rac1 PDB_Info PDB_Structure Homo sapiens | Yersinia pseudotuberculosis Chain A = 5.3e-12 29 33 View alignment SCOP MMDB CATH Chain B = 5.3e-12 29 33 View alignment 2p2l ( Chain: C, A, B) Rac1-gdp-zinc complex PDB_Info PDB_Structure Homo sapiens Chain C = 5.3e-12 29 33 View alignment SCOP MMDB CATH Chain A = 5.3e-12 29 33 View alignment Chain B = 5.3e-12 29 33 View alignment 2atx ( Chain: B, A) Crystal structure of the tc10 gppnhp complex PDB_Info PDB_Structure Homo sapiens Chain B = 5.5e-12 28 35 View alignment SCOP MMDB CATH Chain A = 5.5e-12 28 35 View alignment 2v55 ( Chain: D, B) Mechanism of multi-site phosphorylation from a rock-i:rhoe complex structure PDB_Info PDB_Structure Homo sapiens Chain D = 6.6e-12 29 34 View alignment SCOP MMDB CATH Chain B = 6.6e-12 29 34 View alignment 2ov2 ( Chain: B, H, A, E, F, C, G, D) The crystal structure of the human rac3 in complex with the crib domain of human p21-activated kinase 4 (pak4) PDB_Info PDB_Structure Homo sapiens Chain B = 6.9e-12 30 33 View alignment SCOP MMDB CATH Chain H = 6.9e-12 30 33 View alignment Chain A = 6.9e-12 30 33 View alignment Chain E = 6.9e-12 30 33 View alignment Chain F = 6.9e-12 30 33 View alignment Chain C = 6.9e-12 30 33 View alignment Chain G = 6.9e-12 30 33 View alignment Chain D = 6.9e-12 30 33 View alignment 1gwn ( Chain: A, C) The crystal structure of the core domain of rhoe/rnd3 - a constitutively activated small g protein PDB_Info PDB_Structure Mus musculus Chain A = 6.9e-12 29 34 View alignment SCOP MMDB CATH Chain C = 6.9e-12 29 34 View alignment 2ic5 ( Chain: A, B) Crystal structure of human rac3 grown in the presence of gpp(nh)p. PDB_Info PDB_Structure Homo sapiens Chain A = 6.9e-12 30 33 View alignment SCOP MMDB CATH Chain B = 6.9e-12 30 33 View alignment 2qme ( Chain: A) Crystal structure of human rac3 in complex with crib domain of human p21-activated kinase 1 (pak1) PDB_Info PDB_Structure Homo sapiens 6.9e-12 30 33 View alignment SCOP MMDB CATH 2g0n ( Chain: B, A) The crystal structure of the human rac3 in complex with gdp and chloride PDB_Info PDB_Structure Homo sapiens Chain B = 6.9e-12 30 33 View alignment SCOP MMDB CATH Chain A = 6.9e-12 30 33 View alignment 1g4u ( Chain: R) Crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1 PDB_Info PDB_Structure Salmonella typhimurium | Homo sapiens 7.0e-12 30 32 View alignment SCOP MMDB CATH 1mh1 ( Chain: A) Small g-protein PDB_Info PDB_Structure Homo sapiens 7.1e-12 30 32 View alignment SCOP MMDB CATH 2c2h ( Chain: A, B) Crystal structure of the human rac3 in complex with gdp PDB_Info PDB_Structure Homo sapiens Chain A = 7.5e-12 30 33 View alignment SCOP MMDB CATH Chain B = 7.5e-12 30 33 View alignment 1hh4 ( Chain: A, B) Rac1-rhogdi complex involved in nadph oxidase activation PDB_Info PDB_Structure Homo sapiens Chain A = 7.5e-12 30 32 View alignment SCOP MMDB CATH Chain B = 7.5e-12 30 32 View alignment 2w2x ( Chain: A, B) RAS-RELATED C3 BOTULINU PDB_Info PDB_Structure Unknown Chain A = 1.2e-11 29 34 View alignment SCOP MMDB CATH Chain B = 1.2e-11 29 34 View alignment 2w2v ( Chain: B, D, A, C) RAS-RELATED C3 BOTULINU PDB_Info PDB_Structure Unknown Chain B = 1.2e-11 30 33 View alignment SCOP MMDB CATH Chain D = 1.2e-11 30 33 View alignment Chain A = 1.2e-11 30 33 View alignment Chain C = 1.2e-11 30 33 View alignment 2w2t ( Chain: A) RAS-RELATED C3 BOTULINU PDB_Info PDB_Structure Unknown 1.2e-11 29 34 View alignment SCOP MMDB CATH 1i4t ( Chain: D) Crystal structure analysis of rac1-gmppnp in complex with arfaptin PDB_Info PDB_Structure Homo sapiens 2.0e-11 29 33 View alignment SCOP MMDB CATH 1e96 ( Chain: A) Structure of the rac/p67phox complex PDB_Info PDB_Structure Homo sapiens 2.0e-11 29 33 View alignment SCOP MMDB CATH 2rmk ( Chain: A) Rac1/prk1 complex PDB_Info PDB_Structure Homo sapiens 2.0e-11 29 33 View alignment SCOP MMDB CATH 1ds6 ( Chain: A) Crystal structure of a rac-rhogdi complex PDB_Info PDB_Structure Homo sapiens 6.4e-11 29 34 View alignment