BUD27/YFL023W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVI: 90984 to 93374
CDS: 90984 - 93374

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

BUD27 YFL023W URI1 ORF, Verified S000001871

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2001-03-13. Gene name expires on 2003-03-13.
Description
Protein involved in bud-site selection, nutrient signaling, and gene expression controlled by TOR kinase; diploid mutants show a random budding pattern rather than the wild-type bipolar pattern; plays a role in regulating Ty1 transposition

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2001-03-14 SGD
unfolded protein binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR004127
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cellular bud site selection Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-10 SGD
negative regulation of transposition, RNA-mediated Nyswaner KM, et al. (2008) Chromatin-associated genes protect the yeast genome from ty1 insertional mutagenesis. Genetics 178(1):197-214
         IMP : Inferred from Mutant Phenotype
Assigned on 2008-02-11 SGD
protein folding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR004127
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
cytoplasm Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91
         IDA : Inferred from Direct Assay
Assigned on 2003-10-28 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0963
Assigned on 2008-02-14 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0086
Assigned on 2008-02-13 UniProtKB
prefoldin complex DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR004127
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forBUD27/YFL023W for BUD27
1) Mockli N, et al. (2007) Yeast split-ubiquitin-based cytosolic screening system to detect interactions between transcriptionally active proteins. Biotechniques 42(6):725-30

2) Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

3) Nyswaner KM, et al. (2008) Chromatin-associated genes protect the yeast genome from ty1 insertional mutagenesis. Genetics 178(1):197-214

4) Page N, et al. (2003) A Saccharomyces cerevisiae genome-wide mutant screen for altered sensitivity to K1 killer toxin. Genetics 163(3):875-94

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BUD27/YFL023W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BUD27/YFL023W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MDLLAAS

C-term LHMDSKP

Length(aa) 796

MW(Da) 91,421

pI 4.45

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.019

Codon Adaptation Index 0.135

Frequency of Optimal Codons 0.418

Hydropathicity of Protein -1.051

Aromaticity Score 0.062

10 20 30 40 50 | | | | | MDLLAASVESTLKNLQDKRNFLSEQREHYIDIRSRLVRFINDNDDGEEEG EGQGMVFGDIIISTSKIYLSLGYEYYVEKTKEEAITFVDDKLKLMEDAIE QFNLKIEEAKKTLDNLNHMEDGNGIEEDEANNDEDFLPSMEIREELDDEG NVISSSVTPTTKQPSQSNSKKEQTPAVGPKEKGLAKEKKSKSFEENLKGK LLKRNDEVKKKVQPSKVDTENVYTFADLVQQMDQQDELEDGYIETDEINY DYDAFENSNFKVNDNYEEDDEDEDEEEYLNHSIIPGFEAQSSFLQQIQRL RAQKQSQDHEREEGDVNKSLKPILKKSSFAENSDKKQKKKQVGFASSLEI HEVENLKEENKRQMQSFAVPMYETQESTGIANKMTSDEFDGDLFAKMLGV QEADEVHEKYKEELINQERLEGEASRSNRRTRVSRFRKDRASKKENTLST FKQETTRSVENEVVEKEPVVGDIIEKEPVVGDVIEKEPVVGDVIEKEPAV TDIVEREPAVNDIVERKPVVGDIIEKEPTINDIVEKEPEINSKSEFETPF KKKKLKSLQKPRSSKSMKKKFDPKILENISDDDYDDDDDGNKKLLSNKSK NNTDEQDKFPSKIQEVSRSMAKTGATVGSEPVRITNVDYHALGGNLDDMV KAYSLGLYDDDLEEDPGTIVEKLEDFKEYNKQVELLRDEIRDFQLENKPV TMEEEENDGNVMNDIIEHEFPESYTNDEDEVALHPGRLQEEVAIEYRRLK EATASKWQSSSPAAHTEGELEPIDKFGNPVKTSRFRSQRLHMDSKP*

Protein Structures from PDB: proteins of known structure with sequence similarity to BUD27/YFL023W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
BUD27 2002-08-16 Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Alias Name(s) Reference
URI1 Mockli N, et al. (2007) Yeast split-ubiquitin-based cytosolic screening system to detect interactions between transcriptionally active proteins. Biotechniques 42(6):725-30

Nomenclature History Notes
Date Note
2002-08-16 The name FYV11 was initially reserved for ORF YFL023W, but was never published.

Standard Name	Date Standardized	Reference
BUD27	2002-08-16	Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Alias Name(s)	Reference
URI1	*Mockli N, et al.* (2007)** Yeast split-ubiquitin-based cytosolic screening system to detect interactions between transcriptionally active proteins. Biotechniques 42(6):725-30

Date	Note
2002-08-16	The name FYV11 was initially reserved for ORF YFL023W, but was never published.

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YFL023W SGD Systematic Sequence

850521 NCBI: Gene ID

NP_683715.1 NCBI: RefSeq protein version ID

NP_683715.1 NCBI: RefSeq protein version ID

22532997 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YFL023W	SGD Systematic Sequence
850521	NCBI: Gene ID
NP_683715.1	NCBI: RefSeq protein version ID
NP_683715.1	NCBI: RefSeq protein version ID
22532997	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
16 curated references; 0 references not yet curated
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Regulatory Role
Strains/Constructs
Deplazes A, et al. (2009) Yeast Uri1p promotes translation initiation and may provide a link to cotranslational quality control. EMBO J 28(10):1429-41
       |GCN2 |GCN4 |SSB1 |SSB2 |SUI2 |TIF11 |YKE2
Genetic Interactions
Addinall SG, et al. (2008) A Genomewide Suppressor and Enhancer Analysis of cdc13-1 Reveals Varied Cellular Processes Influencing Telomere Capping in Saccharomyces cerevisiae. Genetics 180(4):2251-66
       |APQ12 |ARC18 |ARV1 |ASC1 |ASE1 |BFA1 |BIM1 |BMH1 |BRE2 |BUB1 |BUB2 |BUB3 |CCS1 |CCZ1 |MORE
Protein-Nucleic Acid Interactions
Substrates/Ligands/Cofactors
Hogan DJ, et al. (2008) Diverse RNA-binding proteins interact with functionally related sets of RNAs, suggesting an extensive regulatory system. PLoS Biol 6(10):e255
         |ACO1 |BFR1 |CBC2 |CBF5 |CLB2 |CLN2 |CLN3 |CPA1 |DHH1 |GBP2 |GCN4 |GIC1 |GIC2 |GPR1 |MORE
Large-scale phenotype analysis
Mutants/Phenotypes
Matsufuji Y, et al. (2008) Acetaldehyde tolerance in Saccharomyces cerevisiae involves the pentose phosphate pathway and oleic acid biosynthesis. Yeast 25(11):825-33
     |ALD3 |ALD6 |AMD1 |ARC1 |ASC1 |BEM4 |CIK1 |COQ3 |CSG2 |ELP2 |ELP3 |GCR2 |GND1 |GSH1 |MORE
Function/Process
Strains/Constructs
Nyswaner KM, et al. (2008) Chromatin-associated genes protect the yeast genome from ty1 insertional mutagenesis. Genetics 178(1):197-214
         |AGP2 |AGP3 |ALR2 |ARC1 |ARG4 |ARG82 |ASC1 |ASF1 |BEM4 |BRE1 |CAN1 |CDC40 |CDC73 |CKB2 |MORE
Mutants/Phenotypes
Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90
       |ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Alvaro D, et al. (2007) Genome-wide analysis of Rad52 foci reveals diverse mechanisms impacting recombination. PLoS Genet 3(12):e228
           |AHC1 |ATR1 |BCK1 |BDF1 |BDF2 |BUB2 |CBT1 |COX16 |CTF19 |CTF4 |DAK2 |DDC1 |DDR2 |ECM11 |MORE
Genetic Interactions
Strains/Constructs
Kitagawa T, et al. (2007) Screening of Drugs That Suppress Ste11 MAPKKK Activation in Yeast Identified a c-Abl Tyrosine Kinase Inhibitor. Biosci Biotechnol Biochem 71(3):772-82
       |HOG1 |HSC82 |HSF1 |PBS2 |STE11 |STI1
Alias
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Techniques and Reagents
Mockli N, et al. (2007) Yeast split-ubiquitin-based cytosolic screening system to detect interactions between transcriptionally active proteins. Biotechniques 42(6):725-30

Protein-protein Interactions
Tronnersjo S, et al. (2007) The jmjN and jmjC domains of the yeast zinc finger protein Gis1 interact with 19 proteins involved in transcription, sumoylation and DNA repair. Mol Genet Genomics 277(1):57-70
       |BMS1 |CSM3 |ESC1 |FIR1 |GDS1 |GIS1 |JIP3 |JIP4 |JIP5 |MFT1 |MGA2 |NFI1 |NIS1 |PAN1 |MORE
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Butcher RA, et al. (2006) Microarray-based method for monitoring yeast overexpression strains reveals small-molecule targets in TOR pathway. Nat Chem Biol 2(2):103-9
         |BMH1 |BRE5 |BUD8 |CAJ1 |DCR2 |DGK1 |ELP2 |FET4 |FPR1 |FRE5 |FSP2 |GEP3 |GIC2 |GIS4 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Proszynski TJ, et al. (2005) A genome-wide visual screen reveals a role for sphingolipids and ergosterol in cell surface delivery in yeast. Proc Natl Acad Sci U S A 102(50):17981-6
       |AYR1 |CCZ1 |CHS5 |ERG4 |ERG6 |FAB1 |GIM3 |KES1 |LCB1 |MCH5 |MON1 |OPI9 |PAC10 |RVS161 |MORE
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Gstaiger M, et al. (2003) Control of nutrient-sensitive transcription programs by the unconventional prefoldin URI. Science 302(5648):1208-12
       |GAT1 |GLN3 |RPB5
Cellular Location
Strains/Constructs
Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91
         |AAH1 |AAP1 |ABZ1 |ABZ2 |ACB1 |ACO2 |ADD37 |ADD66 |ADE1 |ADE12 |ADE2 |ADE3 |ADE4 |ADE6 |MORE
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       |ALG8 |BUD13 |BUD14 |BUD16 |BUD17 |BUD19 |BUD20 |BUD21 |BUD22 |BUD23 |BUD25 |BUD26 |BUD28 |BUD30 |MORE
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2001) Systematic genetic analysis with ordered arrays of yeast deletion mutants. Science 294(5550):2364-8
           |ARC18 |ARC40 |ARP1 |ARP2 |ARP6 |ASE1 |ASF1 |ATS1 |BBC1 |BCK1 |BEM1 |BEM2 |BEM4 |BFA1 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.