BST1/YFL025C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVI: 87232 to 84143
CDS: 87232 - 84143

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

BST1 YFL025C PER17 ORF, Verified S000001869

See Nomenclature Note.

Description
GPI inositol deacylase of the ER that negatively regulates COPII vesicle formation, prevents production of vesicles with defective subunits, required for proper discrimination between resident ER proteins and Golgi-bound cargo molecules

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0378
Assigned on 2007-05-23 UniProtKB
hydrolase activity, acting on ester bonds DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR012908
Assigned on 2008-02-13 UniProtKB
phosphatidylinositol deacylase activity Tanaka S, et al. (2004) Inositol deacylation of glycosylphosphatidylinositol-anchored proteins is mediated by mammalian PGAP1 and yeast Bst1p. J Biol Chem 279(14):14256-63
       IGI : Inferred from Genetic Interaction with GenBank/EMBL/DDBJ:BAD08353
Assigned on 2009-12-07 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ER to Golgi vesicle-mediated transport Elrod-Erickson MJ and Kaiser CA (1996) Genes that control the fidelity of endoplasmic reticulum to Golgi transport identified as suppressors of vesicle budding mutations. Mol Biol Cell 7(7):1043-58
     IMP : Inferred from Mutant Phenotype
Assigned on 2005-04-25 SGD
ER-associated protein catabolic process Vashist S, et al. (2001) Distinct retrieval and retention mechanisms are required for the quality control of endoplasmic reticulum protein folding. J Cell Biol 155(3):355-68
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-25 SGD
GPI anchor metabolic process Tanaka S, et al. (2004) Inositol deacylation of glycosylphosphatidylinositol-anchored proteins is mediated by mammalian PGAP1 and yeast Bst1p. J Biol Chem 279(14):14256-63
       IGI : Inferred from Genetic Interaction with GenBank/EMBL/DDBJ:BAD08353
Assigned on 2004-08-05 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR012908
Assigned on 2008-02-13 UniProtKB
intracellular protein transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR012908
Assigned on 2008-02-13 UniProtKB
protein retention in ER lumen Elrod-Erickson MJ and Kaiser CA (1996) Genes that control the fidelity of endoplasmic reticulum to Golgi transport identified as suppressors of vesicle budding mutations. Mol Biol Cell 7(7):1043-58
     IMP : Inferred from Mutant Phenotype
Assigned on 2005-04-25 SGD
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle organization Elrod-Erickson MJ and Kaiser CA (1996) Genes that control the fidelity of endoplasmic reticulum to Golgi transport identified as suppressors of vesicle budding mutations. Mol Biol Cell 7(7):1043-58
     IMP : Inferred from Mutant Phenotype
IGI : Inferred from Genetic Interaction
Assigned on 2001-06-26 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Elrod-Erickson MJ and Kaiser CA (1996) Genes that control the fidelity of endoplasmic reticulum to Golgi transport identified as suppressors of vesicle budding mutations. Mol Biol Cell 7(7):1043-58
     IDA : Inferred from Direct Assay
Assigned on 2001-06-26 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane Elrod-Erickson MJ and Kaiser CA (1996) Genes that control the fidelity of endoplasmic reticulum to Golgi transport identified as suppressors of vesicle budding mutations. Mol Biol Cell 7(7):1043-58
     ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-06-26 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
intrinsic to endoplasmic reticulum membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR012908
Assigned on 2008-02-13 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for BST1/YFL025C for BST1
Bst1p is a glycosylphosphatidylinositol (GPI) inositol deacylase that mediates inositol deacylation of GPI-anchored proteins, which may be required for their efficient incorporation into COPII transport vesicles through association with cargo receptors (1). An integral membrane protein that resides predominantly in the endoplasmic reticulum (ER), Bst1p negatively regulates COPII vesicle formation, preventing the production of vesicles with defective or missing subunits (2). Bst1p is also required for proper discrimination between resident ER proteins and Golgi-bound cargo molecules (3), and is required for the transport of misfolded proteins to the Golgi, though dispensable for the transport of many normal cargo proteins (2). Bst1p also plays a role in the retrieval to the ER of proteins transported to the Golgi apparatus via COPII-coated vesicles. Bst1p thus represents a novel class of ER proteins that link the regulation of vesicle coat assembly to cargo sorting (3). Null mutations in BST1 suppress mutations in the essential COPII gene SEC13, which is important for the formation of ER to Golgi transport vesicles (3).
Last Updated: 2004-11-02

Basic References [TOP]
BASIC INFORMATION REFERENCES forBST1/YFL025C for BST1
1) Tanaka S, et al. (2004) Inositol deacylation of glycosylphosphatidylinositol-anchored proteins is mediated by mammalian PGAP1 and yeast Bst1p. J Biol Chem 279(14):14256-63

2) Vashist S, et al. (2001) Distinct retrieval and retention mechanisms are required for the quality control of endoplasmic reticulum protein folding. J Cell Biol 155(3):355-68

3) Elrod-Erickson MJ and Kaiser CA (1996) Genes that control the fidelity of endoplasmic reticulum to Golgi transport identified as suppressors of vesicle budding mutations. Mol Biol Cell 7(7):1043-58

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BST1/YFL025C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BST1/YFL025C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MGIRRLV

C-term LFFETIH

Length(aa) 1,029

MW(Da) 117,754

pI 6.72

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.045

Codon Adaptation Index 0.128

Frequency of Optimal Codons 0.433

Hydropathicity of Protein 0.091

Aromaticity Score 0.121

10 20 30 40 50 | | | | | MGIRRLVSVITRPIINKVNSSGQYSRVLATREDQDKASPKYMNNDKIAKK PYTYRLFSILGILSICSLLLISLLKPFNGADAPQCESIYMFPSYARIDGF DERYTPLAHKYHLYLYREQSVDREPLNGDELQLDGIPVLFIPGNAGSFRQ CRSIASACSNIYFDSNTRATLRNENVRNLDFFTADFNEDFTAFHGETMLD QAEYLNDAIKYILSLYERTPDYPHPKPQSVIIVGHSMGGIVSRVMLTLKN HVPGSISTILTLSSPHAASPVTFDGDILKLYKNTNEYWRKQLSQNDSFFS KNISLVSITGGILDTTLPADYASVEDLVSLENGFTSFTTTIPDVWTPIDH LAIVWCKQLREVLARLLLESIDASKPEKVKPLNQRLQIARKLLLSGFEDY SWMNSKLNYPQENLQEFSDNFFSDYATLEMNDVLDFEMFNLEKWHNNYTK INIPSNISSTEHLHFTLLTSLDMPMIYFCTESRVNLSCITAVDSILTVPR SSKDTQFAADSSFGEAKNPFKAVSVGKNILQKYDYLMISKPTYGEFSEQE GMEDNQGFLLALLRNVSNVQIVNTTPSQILLFGEQLHLDGKDIEQVISFS NLWDSLLSYKLETKIEASNEGIASEETLFQPFIRQWVYEPFESKWHLNII NKSLDINMHNVAPFIPLNESEPRSLQLSFFIPPGMSLEAKMTINWSLTLK MLFIRYRLALASFPVAFIALVLSYQFYWYNKTSEFPSFDSTLGYILRKHG ILMFFTLFLASPVVNNKLVQRILYLLDPVGLNYPFLLSERNMHANFYYLG IRDWFMSTIGILFGVMTVGLLALVSKIFGSLEILVIFLQRKLSKKNTEDK EAFDTIEHKAYGKGRLMASVLLLLLVFFHIPYQMAFVISLVIQIATCIRV ALLKLSNNEQKLNLLNYNMTLLLLLLFVSAINIPIIIVFLHNVAIKWETS FRSHHNILAVAPIIFLVGNNSIFKMPNSVPLDTWDGKVTIILFVYLTVFS FIYGIRNLYWIHHLVNIICAWLLFFETIH*

Protein Structures from PDB: proteins of known structure with sequence similarity to BST1/YFL025C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
BST1 SGD (2007) Information without a citation in SGD

Alias Name(s) Reference
PER17 Vashist S, et al. (2001) Distinct retrieval and retention mechanisms are required for the quality control of endoplasmic reticulum protein folding. J Cell Biol 155(3):355-68

Nomenclature History Notes
Date Note
2003-12-09 Both YDR294C/DPL1 and YFL025C/BST1 have been referred to as BST1.
Mapping Notes
Date Note
1997-10-20 Edition 14: The name BST1 was also previously used to refer to YDR294C, which is now called DPL1
Cherry JM, et al. (1997) Genetic and physical maps of Saccharomyces cerevisiae. Nature 387(6632 Suppl):67-73

Standard Name	Reference
BST1	SGD (2007) Information without a citation in SGD

Alias Name(s)	Reference
PER17	*Vashist S, et al.* (2001)** Distinct retrieval and retention mechanisms are required for the quality control of endoplasmic reticulum protein folding. J Cell Biol 155(3):355-68

Date	Note
2003-12-09	Both YDR294C/DPL1 and YFL025C/BST1 have been referred to as BST1.

Date	Note
1997-10-20	Edition 14: The name BST1 was also previously used to refer to YDR294C, which is now called DPL1 *Cherry JM, et al.* (1997)** Genetic and physical maps of Saccharomyces cerevisiae. Nature 387(6632 Suppl):67-73

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YFL025C SGD Systematic Sequence

850519 NCBI: Gene ID

NP_116628.1 NCBI: RefSeq protein version ID

NP_116628.1 NCBI: RefSeq protein version ID

14318494 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YFL025C	SGD Systematic Sequence
850519	NCBI: Gene ID
NP_116628.1	NCBI: RefSeq protein version ID
NP_116628.1	NCBI: RefSeq protein version ID
14318494	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
DNA & RNA Details
Topic Research Highlight Reference Contributor
Other DNA & RNA Details Description: Specifically lower expression in carbon limited chemostat cultures versus carbon excess.
otherTopic: expression
Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74
Viktor Boer
2003-07-25

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
22 curated references; 0 references not yet curated
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Castillon GA, et al. (2009) Concentration of GPI-anchored proteins upon ER exit in yeast. Traffic 10(2):186-200
       |CCW14 |CWP2 |EMP24 |ERV14 |GAP1 |GUP1 |HXT1 |HXT2 |MF(ALPHA)1 |MF(ALPHA)2 |MID2 |PER1 |SEC12 |SEC13 |MORE
Reviews
Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett
     |ARV1 |CDC1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |MORE
Reviews
Fujita M and Jigami Y (2008) Lipid remodeling of GPI-anchored proteins and its function. Biochim Biophys Acta 1780(3):410-20
       |CDC42 |CWH43 |EGT2 |EMP24 |ERI1 |ERV25 |FUR4 |GAS1 |GPI10 |GUP1 |GWT1 |IRE1 |LAS21 |MCD4 |MORE
Mutants/Phenotypes
Herrero AB, et al. (2008) Levels of SCS7/FA2H-Mediated Fatty Acid 2-Hydroxylation Determine the Sensitivity of Cells to Antitumor PM02734. Cancer Res 68(23):9779-87
       |AIM44 |ALD6 |ALG6 |API2 |APL1 |APL5 |APM3 |ATP15 |ATP4 |ATP5 |ATP7 |BRE5 |CAT5 |CBF1 |MORE
Mutants/Phenotypes
Loukin S, et al. (2008) A genome-wide survey suggests an osmoprotective role for vacuolar Ca2+ release in cell wall-compromised yeast. FASEB J 22(7):2405-15
       |ALG5 |ALG6 |ALG8 |CSF1 |DIE2 |GAS1 |GDA1 |GUP1 |HHY1 |HUR1 |KRE1 |KRE6 |LAS21 |MAK10 |MORE
Mutants/Phenotypes
Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90
       |ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE
Reviews
Bosson R and Conzelmann A (2007) Multiple functions of inositolphosphorylceramides in the formation and intracellular transport of glycosylphosphatidylinositol-anchored proteins in yeast. Biochem Soc Symp (74):199-209
     |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |GPI19 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Ghugtyal V, et al. (2007) CWH43 is required for the introduction of ceramides into GPI anchors in Saccharomyces cerevisiae. Mol Microbiol 65(6):1493-502
         |CWH43 |GUP1 |PER1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Haass FA, et al. (2007) Identification of yeast proteins necessary for cell-surface function of a potassium channel. Proc Natl Acad Sci U S A 104(46):18079-18084
       |CSG2 |EMP24 |ERV14 |ERV25 |SUR4 |TED1
Reviews
Orlean P and Menon AK (2007) Thematic review series: lipid posttranslational modifications. GPI anchoring of protein in yeast and mammalian cells, or: how we learned to stop worrying and love glycophospholipids. J Lipid Res 48(5):993-1011
         |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Reviews
Pittet M and Conzelmann A (2007) Biosynthesis and function of GPI proteins in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):405-20
       |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Function/Process
Mutants/Phenotypes
Fujita M, et al. (2006) Inositol deacylation by Bst1p is required for the quality control of glycosylphosphatidylinositol-anchored proteins. Mol Biol Cell 17(2):834-50
           |GAS1 |KAR2
Function/Process
Genetic Interactions
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Mutants/Phenotypes
Strains/Constructs
Wu X and Jiang YW (2005) Genetic/genomic evidence for a key role of polarized endocytosis in filamentous differentiation of S. cerevisiae. Yeast 22(14):1143-53
       |BNI1 |BUD2 |BUD5 |BUD6 |BUD8 |EDE1 |PEA2 |PER1 |RSR1 |RVS161 |SEC22 |SHE4 |SLA1 |SNC2 |MORE
Cross-species Expression
Function/Process
Non-Fungal Related Genes/Proteins
Tanaka S, et al. (2004) Inositol deacylation of glycosylphosphatidylinositol-anchored proteins is mediated by mammalian PGAP1 and yeast Bst1p. J Biol Chem 279(14):14256-63

Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Mutants/Phenotypes
Tucker CL and Fields S (2004) Quantitative genome-wide analysis of yeast deletion strain sensitivities to oxidative and chemical stress. Comp Funct Genomics 5(3):216-24
               |ALF1 |APN2 |ARO1 |ARO2 |ASI1 |BAP2 |BCK1 |BPH1 |CCP1 |CCS1 |COG1 |COG5 |CTR1 |ERD1 |MORE
Function/Process
Mutants/Phenotypes
Enyenihi AH and Saunders WS (2003) Large-scale functional genomic analysis of sporulation and meiosis in Saccharomyces cerevisiae. Genetics 163(1):47-54
           |ADA2 |ADY2 |AKR1 |APS3 |APT1 |ARC1 |ARG82 |ARO2 |ATF1 |ATG11 |ATG15 |ATG16 |ATG5 |BPH1 |MORE
Mutants/Phenotypes
Strains/Constructs
Spear ED and Ng DT (2003) Stress tolerance of misfolded carboxypeptidase Y requires maintenance of protein trafficking and degradative pathways. Mol Biol Cell 14(7):2756-67
             |CPS1 |CUE1 |DER1 |ERV29 |GAS1 |HRD1 |IRE1 |PEP4 |PRC1
Alias
Function/Process
Mutants/Phenotypes
Strains/Constructs
Vashist S, et al. (2001) Distinct retrieval and retention mechanisms are required for the quality control of endoplasmic reticulum protein folding. J Cell Biol 155(3):355-68

Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Elrod-Erickson MJ and Kaiser CA (1996) Genes that control the fidelity of endoplasmic reticulum to Golgi transport identified as suppressors of vesicle budding mutations. Mol Biol Cell 7(7):1043-58
     |BST3 |EMP24 |KAR2 |PDI1 |SEC13
DNA/RNA Sequence Features
Mapping
Murakami Y, et al. (1995) Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae. Nat Genet 10(3):261-8
     |AAD16 |AAD6 |ACT1 |AGP3 |AGX1 |ALR2 |BLM10 |BNA6 |CAK1 |CDC14 |CDC26 |CDC4 |CEN6 |CMK1 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.