---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP133/YKR082W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXI: 592467 to 595940 CDS: 592467 - 595940 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP133	YKR082W	RAT3	ORF, Verified	S000001790
Description
Subunit of the Nup84p subcomplex of the nuclear pore complex (NPC), localizes to both sides of the NPC, required to establish a normal nucleocytoplasmic concentration gradient of the GTPase Gsp1p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural constituent of nuclear pore DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004870 Assigned on 2009-11-20 UniProtKB structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD chromosome localization Therizols P, et al. (2006) Telomere tethering at the nuclear periphery is essential for efficient DNA double strand break repair in subtelomeric region. J Cell Biol 172(2):189-99          IMP : Inferred from Mutant Phenotype Assigned on 2006-02-22 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD nucleocytoplasmic transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004870 Assigned on 2009-11-20 UniProtKB protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Nup107-160 complex Lutzmann M, et al. (2002) Modular self-assembly of a Y-shaped multiprotein complex from seven nucleoporins. EMBO J 21(3):387-97                IDA : Inferred from Direct Assay Assigned on 2009-10-09 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004870 Assigned on 2009-11-20 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2009-11-20 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-11-20 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP133/YKR082W for NUP133 NUP133 encodes a nuclear pore protein that was first identified in a screen for mutations synthetically lethal with a nup49 mutant (1, 2). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 2, 3, 4, 5). The structure of the vertebrate NPC has been studied extensively; recent reviews include 6, 7, 8, and 9. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (10, 11). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 2, 3, 12, 13, 14). NUP133 is not essential; nup133 deletion causes temperature sensitivity, altered distribution (clustering) of nuclear pore complexes, and a defect in RNA export from the nucleus (1, 15, 16, 17, 2). nup133 mutations are also synthetically lethal with mutations in several other nucleoporin genes (2). Last Updated: 1999-08-10

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP133/YKR082W for NUP133 1) Doye V, et al. (1994) A novel nuclear pore protein Nup133p with distinct roles in poly(A)+ RNA transport and nuclear pore distribution. EMBO J 13(24):6062-75      2) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      3) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    4) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      5) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      6) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      7) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      8) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      9) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      10) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      11) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        12) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      13) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        14) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      15) Li O, et al. (1995) Mutation or deletion of the Saccharomyces cerevisiae RAT3/NUP133 gene causes temperature-dependent nuclear accumulation of poly(A)+ RNA and constitutive clustering of nuclear pore complexes. Mol Biol Cell 6(4):401-417      16) Pemberton LF, et al. (1995) Disruption of the nucleoporin gene NUP133 results in clustering of nuclear pore complexes. Proc Natl Acad Sci U S A 92(4):1187-91        17) Sharma K, et al. (1996) Yeast nucleoporin mutants are defective in pre-tRNA splicing. Mol Cell Biol 16(1):294-301        18) Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51        19) Gao H, et al. (2003) Nuclear accumulation of the small GTPase Gsp1p depends on nucleoporins Nup133p, Rat2p/Nup120p, Nup85p, Nic96p, and the acetyl-CoA carboxylase Acc1p. J Biol Chem 278(28):25331-40        20) Allen NP, et al. (2002) Deciphering networks of protein interactions at the nuclear pore complex. Mol Cell Proteomics 1(12):930-46

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP133/YKR082W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP133/YKR082W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSEKKVH C-term ETNTVEY Length(aa) 1,157 MW(Da) 133,319 pI 4.85 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.017   Codon Adaptation Index 0.140   Frequency of Optimal Codons 0.438   Hydropathicity of Protein -0.275   Aromaticity Score 0.106

10 20 30 40 50 | | | | | MSEKKVHLRLRKELSVPIAVVENESLAQLSYEEESQASLMDISMEQQQLR LHSHFDNSKVFTENNRYIVKTLQTDYSSGFSNDDELNGYIDMQIGYGLVN DHKKVYIWNIHSTQKDTPYITVPFRSDDNDEIAVAPRCILTFPATMDESP LALNPNDQDETGGLIIIKGSKAIYYEDINSINNLNFKLSEKFSHELELPI NSSGGEKCDLMLNCEPAGIVLSTNMGRIFFITIRNSMGKPQLKLGKLLNK PFKLGIWSKIFNTNSSVVSLRNGPILGKGTRLVYITTNKGIFQTWQLSAT NSHPTKLIDVNIYEAILESLQDLYPFAHGTLKIWDSHPLQDESSQLFLSS IYDSSCNETYYILSTIIFDSSSNSFTIFSTYRLNTFMESITDTKFKPKIF IPQMENANDTNEVTSILVMFPNAVVITQVNSKLDSSYSMRRKWEDIVSLR NDIDIIGSGYDSKSLYVLTKQMGVLQFFVKENEETNSKPEVGFVKSHVDQ AVYFSKINANPIDFNLPPEISLDQESIEHDLKLTSEEIFHSNGKYIPPML NTLGQHLSVRKEFFQNFLTFVAKNFNYKISPELKLDLIEKFEILNCCIKF NSIIRQSDVLNDIWEKTLSNYNLTQNEHLTTKTVVINSPDVFPVIFKQFL NHVVFVLFPSQNQNFKLNVTNLINLCFYDGILEEGEKTIRYELLELDPME VDTSKLPWFINFDYLNCINQCFFDFTFACEEEGSLDSYKEGLLKIVKILY YQFNQFKIWINTQPVKSVNANDNFININNLYDDNHLDWNHVLCKVNLKEQ CIQIAEFYKDLSGLVQTLQTLDQNDSTTVSLYETFFNEFPKEFSFTLFEY LIKHKKLNDLIFRFPQQHDVLIQFFQESAPKYGHVAWIQQILDGSYADAM NTLKNITVDDSKKGESLSECELHLNVAKLSSLLVEKDNLDINTLRKIQYN LDTIDAEKNISNKLKKGEVQICKRFKNGSIREVFNILVEELKSTTVVNLS DLVELYSMLDDEESLFIPLRLLSVDGNLLNFEVKKFLNALVWRRIVLLNA SNEGDKLLQHIVKRVFDEELPKNNDFPLPSVDLLCDKSLLTPEYISETYG RFPIDQNAIREEIYEEISQVETLNSDNSLEIKLHSTIGSVAKEKNYTINY ETNTVEY*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP133/YKR082W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP133	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YKR082W	SGD Systematic Sequence
853957	NCBI: Gene ID
NP_013008.1	NCBI: RefSeq protein version ID
NP_013008.1	NCBI: RefSeq protein version ID
6322935	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
75 curated references; 0 references not yet curated
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP1 |NUP100 |NUP116 |NUP145 |NUP159 |NUP188 |MORE
Protein-protein Interactions	Luo Y, et al. (2010) Resolving the Composition of Protein Complexes Using a MALDI LTQ Orbitrap. J Am Soc Mass Spectrom 21(1):34-46	|APL1 |APL3 |APM4 |APS2 |ASM4 |BMH2 |EDE1 |FKS1 |NIC96 |NSP1 |NUP120 |NUP145 |NUP159 |NUP170 |MORE
Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Beliakova-Bethell N, et al. (2009) Ty3 nuclear entry is initiated by viruslike particle docking on GLFG nucleoporins. J Virol 83(22):11914-25	|NSP1 |NUP100 |NUP116 |NUP120 |NUP145 |NUP159 |NUP42 |NUP49 |NUP57 |YGR109W-A |YGR109W-B |YIL080W |YIL082W |YIL082W-A
Reviews	Davidson MB and Brown GW (2009) Dissecting the DNA damage response using functional genomics approaches in S. cerevisiae. DNA Repair (Amst) 8(9):1110-7	|ASF1 |CDC34 |CSM3 |CTF13 |CTF18 |CTF4 |CTF8 |DCC1 |DDC1 |DIA2 |DNA2 |DUN1 |ELG1 |LCD1 |MORE
Mutants/Phenotypes Strains/Constructs	Dawson TR, et al. (2009) ER membrane-bending proteins are necessary for de novo nuclear pore formation. J Cell Biol 184(5):659-75	|GLE2 |NEM1 |NIC96 |NUP116 |NUP120 |NUP145 |NUP188 |NUP49 |NUP82 |NUP84 |NUP85 |POM152 |POM34 |RTN1 |MORE
Evolution Non-Fungal Related Genes/Proteins	DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30	|MLP1 |MLP2 |NIC96 |NUP120 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |NUP2 |NUP82 |NUP84 |NUP85
Mutants/Phenotypes Strains/Constructs	Jani D, et al. (2009) Sus1, Cdc31, and the Sac3 CID region form a conserved interaction platform that promotes nuclear pore association and mRNA export. Mol Cell 33(6):727-37	|CDC31 |MEX67 |SAC3 |SUS1 |THP1 |YRA1
Mutants/Phenotypes Strains/Constructs	Lai TP, et al. (2009) Mechanism and a peptide motif for targeting peripheral proteins to the yeast inner nuclear membrane. Traffic 10(9):1243-56	|RNA1 |TRM1
Cellular Location Regulation of	Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73	|APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP100 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location Strains/Constructs	Onischenko E, et al. (2009) Role of the Ndc1 interaction network in yeast nuclear pore complex assembly and maintenance. J Cell Biol 185(3):475-91	|ASM4 |MPS3 |NDC1 |NPL3 |NUP157 |NUP170 |NUP188 |NUP2 |NUP53 |NUP82 |POM152 |POM34
Mutants/Phenotypes Strains/Constructs	Skruzny M, et al. (2009) An endoribonuclease functionally linked to perinuclear mRNP quality control associates with the nuclear pore complexes. PLoS Biol 7(1):e8	|ESC1 |HPR1 |MFT1 |MLP1 |NPL3 |NUP60 |SAC3 |SSA1 |SUB2 |SUS1 |SWT1 |THO2 |THP1 |THP2
Mutants/Phenotypes Strains/Constructs	Westmoreland TJ, et al. (2009) Comparative genome-wide screening identifies a conserved doxorubicin repair network that is diploid specific in Saccharomyces cerevisiae. PLoS ONE 4(6):e5830	|AFG3 |AKR1 |ARP5 |BEM1 |CCR4 |CTF4 |CTK1 |DBF2 |DHH1 |ERG3 |HFI1 |HOM6 |HPR1 |LGE1 |MORE
Genetic Interactions	Addinall SG, et al. (2008) A Genomewide Suppressor and Enhancer Analysis of cdc13-1 Reveals Varied Cellular Processes Influencing Telomere Capping in Saccharomyces cerevisiae. Genetics 180(4):2251-66	|APQ12 |ARC18 |ARV1 |ASC1 |ASE1 |BFA1 |BIM1 |BMH1 |BRE2 |BUB1 |BUB2 |BUB3 |BUD27 |CCS1 |MORE
Mutants/Phenotypes Strains/Constructs	Andersen MP, et al. (2008) A Genetic Screen for Increased Loss of Heterozygosity in Saccharomyces cerevisiae. Genetics 179(3):1179-95	|ADK1 |ASF1 |ATG17 |CCR4 |CDH1 |CHL4 |CLB5 |CSM1 |CSM3 |CTF19 |CTK3 |DCC1 |DPB3 |DUN1 |MORE
Genetic Interactions	Bennett CB, et al. (2008) Yeast Screens Identify the RNA Polymerase II CTD and SPT5 as Relevant Targets of BRCA1 Interaction. PLoS ONE 3(1):e1448	|APT1 |ASM4 |ATE1 |BBC1 |BEM4 |BUR2 |CCR4 |CTK1 |DAN1 |DEF1 |DHH1 |GYP5 |HDA3 |MET18 |MORE
Cellular Location Strains/Constructs	Brohawn SG, et al. (2008) Structural evidence for common ancestry of the nuclear pore complex and vesicle coats. Science 322(5906):1369-73	|NIC96 |NUP145 |NUP84 |SEC13 |SEC31 |SEH1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gonzalez-Aguilera C, et al. (2008) The THP1-SAC3-SUS1-CDC31 complex works in transcription elongation-mRNA export preventing RNA-mediated genome instability. Mol Biol Cell 19(10):4310-8	|DBP5 |GLE1 |HPR1 |MEX67 |MTR4 |NAB2 |NUP120 |NUP60 |NUP84 |PAP1 |RAT1 |RRP6 |SAC3 |SUB2 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hung NJ, et al. (2008) Arx1 Is a Nuclear Export Receptor for the 60S Ribosomal Subunit in Yeast. Mol Biol Cell 19(2):735-44	|ARX1 |CRM1 |GLE2 |MEX67 |MTR2 |NIC96 |NMD3 |NSP1 |NUP100 |NUP116 |NUP120 |NUP42 |NUP57 |NUP82 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Nagai S, et al. (2008) Functional targeting of DNA damage to a nuclear pore-associated SUMO-dependent ubiquitin ligase. Science 322(5901):597-602	|ARS607 |MEC1 |NUP120 |NUP49 |NUP60 |NUP84 |SLX5 |SLX8
Mutants/Phenotypes Strains/Constructs	Shcheprova Z, et al. (2008) A mechanism for asymmetric segregation of age during yeast budding. Nature 454(7205):728-34	|BNR1 |BUD6 |CDC12 |FOB1 |MLP1 |MLP2 |NIC96 |NSG1 |NUP49 |PRM3 |SEC61 |SHS1
Mutants/Phenotypes	Thomsen R, et al. (2008) General, rapid, and transcription-dependent fragmentation of nucleolar antigens in S. cerevisiae mRNA export mutants. RNA 14(4):706-16	|ASM4 |HPR1 |HSP104 |MEX67 |MFT1 |NOP1 |NOP58 |NSR1 |NUP100 |NUP120 |NUP159 |NUP188 |NUP2 |NUP42 |MORE
Genetic Interactions	Willis IM, et al. (2008) Genetic interactions of MAF1 identify a role for Med20 in transcriptional repression of ribosomal protein genes. PLoS Genet 4(7):e1000112	|ACS2 |BRP1 |BUD20 |DED81 |ERG12 |FYV5 |GCD10 |GRC3 |GYP1 |HCR1 |ILM1 |IRC13 |KEM1 |KRS1 |MORE
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Alvaro D, et al. (2007) Genome-wide analysis of Rad52 foci reveals diverse mechanisms impacting recombination. PLoS Genet 3(12):e228	|AHC1 |ATR1 |BCK1 |BDF1 |BDF2 |BUB2 |BUD27 |CBT1 |COX16 |CTF19 |CTF4 |DAK2 |DDC1 |DDR2 |MORE
Function/Process Genetic Interactions	Chen XL, et al. (2007) Topoisomerase I-Dependent Viability Loss in Saccharomyces cerevisiae Mutants Defective in Both SUMO Conjugation and DNA Repair. Genetics 177(1):17-30	|MRE11 |NFI1 |NUP60 |RAD27 |RAD50 |RAD51 |RAD52 |RAD54 |RAD55 |RAD57 |SIZ1 |TOP1 |TRI1 |ULP1 |MORE
Mutants/Phenotypes Strains/Constructs	Liao C, et al. (2007) Genomic Screening in Vivo Reveals the Role Played by Vacuolar H+ ATPase and Cytosolic Acidification in Sensitivity to DNA-Damaging Agents Such as Cisplatin. Mol Pharmacol 71(2):416-25	|ASF1 |ATP2 |BUD31 |BUR2 |CLB2 |CTF18 |CTF4 |CTF8 |DBF2 |DCC1 |DOC1 |EAP1 |ERG24 |GCN5 |MORE
Reviews	Maxwell PH and Curcio MJ (2007) Host factors that control long terminal repeat retrotransposons in Saccharomyces cerevisiae: implications for regulation of mammalian retroviruses. Eukaryot Cell 6(7):1069-80	|BRO1 |CPR7 |DBP3 |DBR1 |DEP1 |ELG1 |NUP84 |POP2 |RIM13 |RPL6A |RRM3 |RTT101 |RTT103 |RTT109 |MORE
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Palancade B, et al. (2007) Nucleoporins prevent DNA damage accumulation by modulating Ulp1-dependent sumoylation processes. Mol Biol Cell 18(8):2912-23	|MRE11 |NUP120 |NUP60 |RAD27 |RAD50 |RAD51 |RAD52 |RAD54 |RAD55 |SLX5 |SLX8 |SRS2 |ULP1 |YKU70
Regulatory Role	Sarma NJ, et al. (2007) Glucose-responsive regulators of gene expression in Saccharomyces cerevisiae function at the nuclear periphery via a reverse recruitment mechanism. Genetics 175(3):1127-35	|GAL83 |HXK2 |MIG1 |NUP120 |NUP145 |NUP84 |SEC13 |SNF1 |SNF4 |SUC2
Mutants/Phenotypes	Stelter P, et al. (2007) Molecular basis for the functional interaction of dynein light chain with the nuclear-pore complex. Nat Cell Biol 9(7):788-96	|DYN1 |DYN2 |NSP1 |NUP159 |NUP82 |PEX14
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Fungal Related Genes/Proteins Regulation of Transcription	Tsai HK, et al. (2007) Co-expression of adjacent genes in yeast cannot be simply attributed to shared regulatory system. BMC Genomics 8:352	|ALB1 |BRE2 |CTR9 |ECM16 |FYV7 |GCD10 |ICE2 |IRC19 |LCP5 |MRPL16 |MTC1 |NIP7 |NOG1 |NOP1 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |MORE
Mutants/Phenotypes	Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401	|AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Genetic Interactions	Tabuchi M, et al. (2006) The phosphatidylinositol 4,5-biphosphate and TORC2 binding proteins Slm1 and Slm2 function in sphingolipid regulation. Mol Cell Biol 26(15):5861-75	|AUR1 |BCK1 |CMP2 |CNB1 |CSG2 |FEN1 |GAS1 |GIM3 |INO2 |INO4 |ISC1 |KRE1 |LDB16 |MSS4 |MORE
Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Therizols P, et al. (2006) Telomere tethering at the nuclear periphery is essential for efficient DNA double strand break repair in subtelomeric region. J Cell Biol 172(2):189-99	|ESC1 |NUP120 |NUP145 |NUP170 |NUP53 |NUP84 |SIR4 |TEL11L |YKU70
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Loeillet S, et al. (2005) Genetic network interactions among replication, repair and nuclear pore deficiencies in yeast. DNA Repair (Amst) 4(4):459-68	|NUP120 |NUP84 |RAD27 |RAD52
Protein Physical Properties Protein-protein Interactions Strains/Constructs	Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51	|GLE2 |KAP123 |MEX67 |MLP1 |NIC96 |NSP1 |NUP116 |NUP120 |NUP145 |NUP157 |NUP159 |NUP170 |NUP49 |NUP57 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Menon BB, et al. (2005) Reverse recruitment: the Nup84 nuclear pore subcomplex mediates Rap1/Gcr1/Gcr2 transcriptional activation. Proc Natl Acad Sci U S A 102(16):5749-54	|GCN4 |GCR1 |GCR2 |KAP123 |NOP1 |NUP120 |NUP145 |NUP53 |NUP84 |NUP85 |POM152 |POM34 |RAP1 |SEC13 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Palancade B, et al. (2005) Pml39, a novel protein of the nuclear periphery required for nuclear retention of improper messenger ribonucleoparticles. Mol Biol Cell 16(11):5258-68	|MLP1 |MLP2 |NAB2 |NUP120 |NUP157 |NUP60 |PML1 |PML39 |RRP6 |YRA1
Fungal Related Genes/Proteins	Bai SW, et al. (2004) The fission yeast Nup107-120 complex functionally interacts with the small GTPase Ran/Spi1 and is required for mRNA export, nuclear pore distribution, and proper cell division. Mol Cell Biol 24(14):6379-92	|GSP1 |NUP120 |NUP84 |NUP85 |SEH1
Fungal Related Genes/Proteins	Chen XQ, et al. (2004) Identification of genes encoding putative nucleoporins and transport factors in the fission yeast Schizosaccharomyces pombe: a deletion analysis. Yeast 21(6):495-509	|CSE1 |MLP1 |NUP120 |NUP2 |NUP53 |NUP84 |NUP85
Mutants/Phenotypes Strains/Constructs	Taddei A, et al. (2004) Separation of silencing from perinuclear anchoring functions in yeast Ku80, Sir4 and Esc1 proteins. EMBO J 23(6):1301-12	|ESC1 |SIR2 |SIR4 |YKU80
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP145 |NUP157 |NUP159 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Gao H, et al. (2003) Nuclear accumulation of the small GTPase Gsp1p depends on nucleoporins Nup133p, Rat2p/Nup120p, Nup85p, Nic96p, and the acetyl-CoA carboxylase Acc1p. J Biol Chem 278(28):25331-40	|ACC1 |GSP1 |NIC96 |NTF2 |NUP120 |NUP85 |SRM1
Mutants/Phenotypes Regulatory Role	Griffith JL, et al. (2003) Functional genomics reveals relationships between the retrovirus-like Ty1 element and its host Saccharomyces cerevisiae. Genetics 164(3):867-79	|APN1 |ARD1 |BEM1 |BUD30 |CBC2 |CTK1 |DBR1 |DOA4 |HOF1 |JNM1 |KCS1 |LSM1 |MCK1 |MFT1 |MORE
Protein-protein Interactions	Allen NP, et al. (2002) Deciphering networks of protein interactions at the nuclear pore complex. Mol Cell Proteomics 1(12):930-46	|CRM1 |CSE1 |GSP1 |KAP95 |MEX67 |NUP100 |NUP116 |NUP120 |NUP159 |NUP2 |NUP49 |NUP84 |NUP85 |PAB1 |MORE
Mutants/Phenotypes Strains/Constructs	Chang M, et al. (2002) A genome-wide screen for methyl methanesulfonate-sensitive mutants reveals genes required for S phase progression in the presence of DNA damage. Proc Natl Acad Sci U S A 99(26):16934-9	|AAT2 |APN1 |ARO1 |ARO7 |ASF1 |BDF1 |BUD25 |BUR2 |CAC2 |CCS1 |CDC40 |CDC50 |CHL1 |CIK1 |MORE
Protein Physical Properties Protein-protein Interactions Strains/Constructs	Lutzmann M, et al. (2002) Modular self-assembly of a Y-shaped multiprotein complex from seven nucleoporins. EMBO J 21(3):387-97	|NUP120 |NUP145 |NUP84 |NUP85 |SEC13 |SEH1
Non-Fungal Related Genes/Proteins	Belgareh N, et al. (2001) An evolutionarily conserved NPC subcomplex, which redistributes in part to kinetochores in mammalian cells. J Cell Biol 154(6):1147-60	|NUP120 |NUP84
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP145 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	de Bruyn Kops A and Guthrie C (2001) An essential nuclear envelope integral membrane protein, Brr6p, required for nuclear transport. EMBO J 20(15):4183-93	|BRR6
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Alias Mapping Mutants/Phenotypes Strains/Constructs	Zuniga S, et al. (1999) Deletion of 24 open reading frames from chromosome XI from Saccharomyces cerevisiae and phenotypic analysis of the deletants. Gene 233(1-2):141-50	|ALY1 |DAD2 |DBP7 |ESL2 |FCJ1 |IRS4 |NTR2 |OMA1 |PRY2 |PXL1 |RPC37 |RPF2 |SRL3 |TGL4 |MORE
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs Techniques and Reagents	Belgareh N and Doye V (1997) Dynamics of nuclear pore distribution in nucleoporin mutant yeast cells. J Cell Biol 136(4):747-59	|NUP49
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |NUP49 |MORE
Other Features	Goldstein AL, et al. (1996) Pleiotropic nuclear defects associated with a conditional allele of the novel nucleoporin Rat9p/Nup85p. Mol Biol Cell 7(6):917-34	|NUP120 |NUP85
Reviews	Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Mutants/Phenotypes Strains/Constructs	Sharma K, et al. (1996) Yeast nucleoporin mutants are defective in pre-tRNA splicing. Mol Cell Biol 16(1):294-301	|NSP1 |NUP1 |NUP100 |NUP116 |NUP145 |NUP49 |NUP85
Function/Process Mutants/Phenotypes Strains/Constructs	Simos G, et al. (1996) Nuclear pore proteins are involved in the biogenesis of functional tRNA. EMBO J 15(9):2270-84	|LOS1 |NSP1 |NUP116 |NUP85 |PUS1 |PUS2
Fungal Related Genes/Proteins	Aitchison JD, et al. (1995) Nup120p: a yeast nucleoporin required for NPC distribution and mRNA transport. J Cell Biol 131(6 Pt 2):1659-75	|NUP120
Reviews	Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Reviews	Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41	|NIC96 |NUP100 |NUP116 |NUP159 |NUP188 |NUP2 |NUP57 |NUP82 |NUP84 |NUP85 |POM152
Alias Genetic Interactions	Heath CV, et al. (1995) Nuclear pore complex clustering and nuclear accumulation of poly(A)+ RNA associated with mutation of the Saccharomyces cerevisiae RAT2/NUP120 gene. J Cell Biol 131(6 Pt 2):1677-97	|NUP120 |NUP159
Alias Cellular Location Mutants/Phenotypes Strains/Constructs	Li O, et al. (1995) Mutation or deletion of the Saccharomyces cerevisiae RAT3/NUP133 gene causes temperature-dependent nuclear accumulation of poly(A)+ RNA and constitutive clustering of nuclear pore complexes. Mol Biol Cell 6(4):401-417
Cellular Location Mapping Mutants/Phenotypes Protein Physical Properties Strains/Constructs	Pemberton LF, et al. (1995) Disruption of the nucleoporin gene NUP133 results in clustering of nuclear pore complexes. Proc Natl Acad Sci U S A 92(4):1187-91	|NUP145
Alias Cellular Location Genetic Interactions Mutants/Phenotypes Strains/Constructs	Doye V, et al. (1994) A novel nuclear pore protein Nup133p with distinct roles in poly(A)+ RNA transport and nuclear pore distribution. EMBO J 13(24):6062-75	|NUP49

Return to SGD

Send a Message to the SGD Curators