SAC1/YKL212W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXI: 34544 to 36415
CDS: 34544 - 36415
Genetic position: -153.8 cM
Genetic Map Data

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

SAC1 YKL212W RSD1 ORF, Verified S000001695

Description
Phosphatidylinositol phosphate (PtdInsP) phosphatase involved in hydrolysis of PtdIns[4]P; transmembrane protein localizes to ER and Golgi; involved in protein trafficking and processing, secretion, and cell wall maintenance

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0378
Assigned on 2008-02-14 UniProtKB
phosphatidylinositol-3,5-bisphosphate 5-phosphatase activity Hughes WE, et al. (2000) SAC1 encodes a regulated lipid phosphoinositide phosphatase, defects in which can be suppressed by the homologous Inp52p and Inp53p phosphatases. J Biol Chem 275(2):801-8
       IDA : Inferred from Direct Assay
Assigned on 2008-06-09 SGD
phosphatidylinositol-3-phosphatase activity Hughes WE, et al. (2000) SAC1 encodes a regulated lipid phosphoinositide phosphatase, defects in which can be suppressed by the homologous Inp52p and Inp53p phosphatases. J Biol Chem 275(2):801-8
       IDA : Inferred from Direct Assay
Assigned on 2008-06-09 SGD
phosphatidylinositol-4-phosphate phosphatase activity Hughes WE, et al. (2000) SAC1 encodes a regulated lipid phosphoinositide phosphatase, defects in which can be suppressed by the homologous Inp52p and Inp53p phosphatases. J Biol Chem 275(2):801-8
       IDA : Inferred from Direct Assay
Assigned on 2008-06-09 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
phosphoinositide dephosphorylation Hughes WE, et al. (2000) SAC1 encodes a regulated lipid phosphoinositide phosphatase, defects in which can be suppressed by the homologous Inp52p and Inp53p phosphatases. J Biol Chem 275(2):801-8
       IDA : Inferred from Direct Assay
IMP : Inferred from Mutant Phenotype
IGI : Inferred from Genetic Interaction with SGD:INP52, SGD:INP53
Assigned on 2005-03-31 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2008-02-14 UniProtKB
integral to Golgi membrane Whitters EA, et al. (1993) SAC1p is an integral membrane protein that influences the cellular requirement for phospholipid transfer protein function and inositol in yeast. J Cell Biol 122(1):79-94
     IDA : Inferred from Direct Assay
Assigned on 2002-08-02 SGD
Faulhammer F, et al. (2005) Cell growth-dependent coordination of lipid signaling and glycosylation is mediated by interactions between Sac1p and Dpm1p. J Cell Biol 168(2):185-91
       IMP : Inferred from Mutant Phenotype
IDA : Inferred from Direct Assay
Assigned on 2008-06-09 SGD
integral to endoplasmic reticulum membrane Whitters EA, et al. (1993) SAC1p is an integral membrane protein that influences the cellular requirement for phospholipid transfer protein function and inositol in yeast. J Cell Biol 122(1):79-94
     IDA : Inferred from Direct Assay
Assigned on 2002-08-02 SGD
Foti M, et al. (2001) Sac1 lipid phosphatase and Stt4 phosphatidylinositol 4-kinase regulate a pool of phosphatidylinositol 4-phosphate that functions in the control of the actin cytoskeleton and vacuole morphology. Mol Biol Cell 12(8):2396-411
       IMP : Inferred from Mutant Phenotype
IDA : Inferred from Direct Assay
Assigned on 2008-06-09 SGD
Faulhammer F, et al. (2005) Cell growth-dependent coordination of lipid signaling and glycosylation is mediated by interactions between Sac1p and Dpm1p. J Cell Biol 168(2):185-91
       IMP : Inferred from Mutant Phenotype
IDA : Inferred from Direct Assay
Assigned on 2008-06-09 SGD
Konrad G, et al. (2002) Retention of the yeast Sac1p phosphatase in the endoplasmic reticulum causes distinct changes in cellular phosphoinositide levels and stimulates microsomal ATP transport. J Biol Chem 277(12):10547-54
         IMP : Inferred from Mutant Phenotype
Assigned on 2008-06-09 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9904
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
mitochondrial outer membrane Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50
         IDA : Inferred from Direct Assay
Assigned on 2006-03-17 SGD
mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
         IDA : Inferred from Direct Assay
Assigned on 2004-09-28 SGD
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
           IDA : Inferred from Direct Assay
Assigned on 2006-12-12 SGD

Pathways [TOP] [NEXT]
phosphatidylinositol phosphate biosynthesis

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for SAC1/YKL212W for SAC1
SAC1 encodes a lipid phosphatase that is involved in many cellular processes, such as cell wall maintenance and membrane and protein trafficking, through regulating levels of phosphotidylinositol (PtdIns) phosphates (reviewed in 1). Although Sac1p is able to dephosphorylate PtdIns[3]P, PtdIns[4]P, and PtdIns[3,5]P2 in vitro, the role of Sac1p in processes involving PtdIns[4]P has been the primary focus of in vivo studies (2, reviewed in 1). Sac1p specifically acts upon PtdIns(4)P produced by the PtdIns 4-kinase Stt4p and acts as antagonist to the PtdIns 4-kinase Pik1p (3, 4).
Sac1p is a type II transmembrane protein that localizes to the Golgi and the ER. This subcompartmentalization of the phosphatase determines which processes it regulates (5, 6, 3). Golgi-localized Sac1p is involved in Golgi trafficking and cell wall maintenance, while ER-localized Sac1p participates in ATP uptake into the ER, ER-based secretion and protein processing, and vacuolar function (4, 5, 3 and references therein). Localization of Sac1p is regulated by growth conditions as well as interactions with proteins such as Dpm1p (7). Expression of SAC1 is regulated in response to changing levels of PtdIns[4]P (8).
SAC1 was originally identified as a suppressor of the temperature-conditional act1-1 allele, and thus some of the phenotypes seen in the sac1 mutant are similar to those of actin mutants, such as defects in actin cytoskeleton polarization and abnormal chitin deposition (9). sac1 null phenotypes also include cold sensitivity, inositol auxotrophy, fragmented vacuoles, accumulation of lipid droplets, elevated levels of PtdIns[4]P, calcofluor white sensitivity, and constitutively-activated unfolded protein response (9, and reviewed in 1).
Sac1p is the founding member of a family of PtdIns phosphatases that share a catalytic domain known as the Sac1-like domain. In S. cerevisiae, this family includes the phosphatases Fig4p, Inp51p, Inp52p, and Inp53p, all of partially overlapping function. All of the Sac1-like domain containing proteins are highly conserved from yeast to human; mammalian members of this protein family include synaptojanin-1 (SYNJ1) and synaptojanin -2 (SYNJ2) (reviewed in 1).
About Phosphatidylinositol Phosphate Biosynthesis
The phosphorylated products of phosphatidylinositol (PtdIns, PI), collectively referred to as phosphoinositides or phosphatidylinositol phosphates (PtdInsPs, PIPs), are membrane-bound lipids that function as structural components of membranes, as well as regulators of many cellular processes in eukaryotes, including vesicle-mediated membrane trafficking, cell wall integrity, and actin cytoskeleton organization (reviewed in 1 and 10). PtdInsPs are also precursors of the water-soluble inositol phosphates (IPs), an important class of intracellular signaling molecules (reviewed in 11, 12 and 13).
The inositol ring of the membrane phospholipids and the water-soluble IPs are readily phosphorylated and dephosphorylated at a number of positions making them well suited as key regulators. PtdIns can be phosphorylated at one or a combination of positions (3', 4', or 5') on the inositol headgroup, generating a set of unique stereoisomers that have specific biological functions (reviewed in 1). These stereoisomers have been shown to be restricted to certain membranes (reviewed in 1). Phosphatidylinositol 4-phosphate (PtdIns4P) is the major PtdInsP species of the Golgi apparatus, where it plays a role in the vesicular trafficking of secretory proteins from the Golgi to the plasma membrane (reviewed in 1). Phosphatidylinositol 4,5-bisphosphate (PtdIns[4,5]P2) is the major species found at the plasma membrane and is involved in the regulation of actin cytoskeleton organization, as well as cell wall integrity, and heat shock response pathways (reviewed in 1). Phosphatidylinositol 3-phosphate (PtdIns3P) is found predominantly at endosomal membranes and in multivesicular bodies (MVB), where it plays a role in endosomal and vacuolar membrane trafficking. Phosphatidylinositol 3,5-bisphosphate (PtdIns[3,5]P2) is found on vacuolar membranes where it plays an important role in the MVB sorting pathway (reviewed in 1).
Phosphorylation and dephosphorylation of the inositol headgroups of PtdInsPs at specific membrane locations signals the recruitment of certain proteins essential for vesicular transport (10, and reviewed in 1). PtdInsPs recruit proteins that contain PtdInsP-specific binding domains, such as the well-studied pleckstrin homology (PH) domain that recognizes the phosphorylation pattern of specific PtdInsP inositol headgroups (reviewed in 1).
A number of kinases and phosphatases are involved in the generation and interconversions of PtdInsPs, the majority of which have been well conserved during evolution (reviewed in 1). The PtdInsP kinases, in contrast to the lipid phosphatases, have a higher degree of specificity. While each kinase appears to phosphorylate only one substrate, many of the lipid phosphatases can dephosphorylate a number of substrates.
Last Updated: 2008-06-26

Basic References [TOP]
BASIC INFORMATION REFERENCES forSAC1/YKL212W for SAC1
1) Strahl T and Thorner J (2007) Synthesis and function of membrane phosphoinositides in budding yeast, Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):353-404

2) Guo S, et al. (1999) SAC1-like domains of yeast SAC1, INP52, and INP53 and of human synaptojanin encode polyphosphoinositide phosphatases. J Biol Chem 274(19):12990-5

3) Foti M, et al. (2001) Sac1 lipid phosphatase and Stt4 phosphatidylinositol 4-kinase regulate a pool of phosphatidylinositol 4-phosphate that functions in the control of the actin cytoskeleton and vacuole morphology. Mol Biol Cell 12(8):2396-411

4) Schorr M, et al. (2001) The phosphoinositide phosphatase Sac1p controls trafficking of the yeast Chs3p chitin synthase. Curr Biol 11(18):1421-6

5) Konrad G, et al. (2002) Retention of the yeast Sac1p phosphatase in the endoplasmic reticulum causes distinct changes in cellular phosphoinositide levels and stimulates microsomal ATP transport. J Biol Chem 277(12):10547-54

6) Whitters EA, et al. (1993) SAC1p is an integral membrane protein that influences the cellular requirement for phospholipid transfer protein function and inositol in yeast. J Cell Biol 122(1):79-94

7) Faulhammer F, et al. (2005) Cell growth-dependent coordination of lipid signaling and glycosylation is mediated by interactions between Sac1p and Dpm1p. J Cell Biol 168(2):185-91

8) Knodler A, et al. (2008) Expression of yeast lipid phosphatase Sac1p is regulated by phosphatidylinositol-4-phosphate. BMC Mol Biol 9:16

9) Novick P, et al. (1989) Suppressors of yeast actin mutations. Genetics 121(4):659-74

10) De Camilli P, et al. (1996) Phosphoinositides as regulators in membrane traffic. Science 271(5255):1533-9

11) York JD (2006) Regulation of nuclear processes by inositol polyphosphates. Biochim Biophys Acta 1761(5-6):552-9

12) Bennett M, et al. (2006) Inositol pyrophosphates: metabolism and signaling. Cell Mol Life Sci 63(5):552-64

13) Bhandari R, et al. (2007) Inositol pyrophosphate pyrotechnics. Cell Metab 5(5):321-3

14) Cleves AE, et al. (1989) Mutations in the SAC1 gene suppress defects in yeast Golgi and yeast actin function. J Cell Biol 109(6 Pt 1):2939-50

15) Hughes WE, et al. (2000) SAC1 encodes a regulated lipid phosphoinositide phosphatase, defects in which can be suppressed by the homologous Inp52p and Inp53p phosphatases. J Biol Chem 275(2):801-8

16) Drubin, D. and Botstein, D. (1989) Personal Communication, Mortimer Map Edition 10

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SAC1/YKL212W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SAC1/YKL212W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MTGPIVY

C-term PDPLKRD

Length(aa) 623

MW(Da) 71,124

pI 7.75

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.200

Codon Adaptation Index 0.206

Frequency of Optimal Codons 0.528

Hydropathicity of Protein -0.335

Aromaticity Score 0.120

10 20 30 40 50 | | | | | MTGPIVYVQNADGIFFKLAEGKGTNDAVIHLANQDQGVRVLGAEEFPVQG EVVKIASLMGFIKLKLNRYAIIANTVEETGRFNGHVFYRVLQHSIVSTKF NSRIDSEEAEYIKLLELHLKNSTFYFSYTYDLTNSLQRNEKVGPAASWKT ADERFFWNHYLTEDLRNFAHQDPRIDSFIQPVIYGYAKTVDAVLNATPIV LGLITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLAENPESEKIHVF SFLQTRGSVPIYWAEINNLKYKPNLVLGENSLDATKKHFDQQKELYGDNY LVNLVNQKGHELPVKEGYESVVHALNDPKIHYVYFDFHHECRKMQWHRVK LLIDHLEKLGLSNEDFFHKVIDSNGNTVEIVNEQHSVVRTNCMDCLDRTN VVQSVLAQWVLQKEFESADVVATGSTWEDNAPLLTSYQNLWADNADAVSV AYSGTGALKTDFTRTGKRTRLGAFNDFLNSASRYYQNNWTDGPRQDSYDL FLGGFRPHTASIKSPFPDRRPVYIQLIPMIICAALTVLGATIFFPKDRFT SSKNLLYFAGASIVLALSTKFMFKNGIQFVNWPKLVDVGFLVVHQTHDKE QQFKGLKYAQSPKFSKPDPLKRD*

Protein Structures from PDB: proteins of known structure with sequence similarity to SAC1/YKL212W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
SAC1 Drubin, D. and Botstein, D. (1989) Personal Communication, Mortimer Map Edition 10

Alias Name(s) Reference
RSD1 Cleves AE, et al. (1989) Mutations in the SAC1 gene suppress defects in yeast Golgi and yeast actin function. J Cell Biol 109(6 Pt 1):2939-50

Standard Name	Reference
SAC1	Drubin, D. and Botstein, D. (1989) Personal Communication, Mortimer Map Edition 10

Alias Name(s)	Reference
RSD1	*Cleves AE, et al.* (1989)** Mutations in the SAC1 gene suppress defects in yeast Golgi and yeast actin function. J Cell Biol 109(6 Pt 1):2939-50

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YKL212W SGD Systematic Sequence

853668 NCBI: Gene ID

NP_012710.1 NCBI: RefSeq protein version ID

NP_012710.1 NCBI: RefSeq protein version ID

6322637 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YKL212W	SGD Systematic Sequence
853668	NCBI: Gene ID
NP_012710.1	NCBI: RefSeq protein version ID
NP_012710.1	NCBI: RefSeq protein version ID
6322637	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
92 curated references; 0 references not yet curated
Protein Processing/Modification/Regulation
Kim JH, et al. (2010) Oxidative stress studies in yeast with a frataxin mutant: a proteomics perspective. J Proteome Res 9(2):730-6
       |ACC1 |ADH1 |CCH1 |CDC19 |CFD1 |CRN1 |ENO2 |FBA1 |GDH2 |HSP26 |ILV6 |MIS1 |MRE11 |MRPL10 |MORE
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Puts CF, et al. (2010) A P(4)-ATPase Protein Interaction Network Reveals a Link between Aminophospholipid Transport and Phosphoinositide Metabolism. J Proteome Res 9(2):833-42
       |ACC1 |ARC1 |CDC50 |DRS2 |INO1 |ITR1 |KAR2 |MHP1 |PYC1 |PYC2 |SEC26 |SSD1 |TCB3 |VNX1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Aghamohammadzadeh S and Ayscough KR (2009) Differential requirements for actin during yeast and mammalian endocytosis. Nat Cell Biol 11(8):1039-42
       |ABP1 |PPZ1 |PPZ2 |SCP1
Mutants/Phenotypes
Strains/Constructs
Banuelos MG, et al. (2009) Genomic analysis of severe hypersensitivity to hygromycin B reveals linkage to vacuolar defects and new vacuolar gene functions in Saccharomyces cerevisiae. Curr Genet
     |ARF1 |BUD32 |BUR2 |CHC1 |CIN5 |CPA1 |DBP7 |DHH1 |DRS2 |ERG6 |GET2 |GLN3 |HHY1 |ISM1 |MORE
Mutants/Phenotypes
Strains/Constructs
Brice SE, et al. (2009) Modulation of Sphingolipid Metabolism by the Phosphatidylinositol-4-phosphate Phosphatase Sac1p through Regulation of Phosphatidylinositol in Saccharomyces cerevisiae. J Biol Chem 284(12):7588-96
       |AGP2 |AUR1 |STT4
Strains/Constructs
Techniques and Reagents
Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif
       |AAC1 |AAC3 |ADP1 |ALG3 |ALG7 |BOR1 |CHO1 |DGA1 |DPP1 |ENA5 |EPT1 |GPT2 |LPP1 |NFT1 |MORE
Mutants/Phenotypes
Strains/Constructs
Gaillard H, et al. (2009) Genome-wide analysis of factors affecting transcription elongation and DNA repair: a new role for PAF and Ccr4-not in transcription-coupled repair. PLoS Genet 5(2):e1000364
           |BRE1 |BUR2 |CCR4 |CDC73 |CTK3 |DEF1 |EST2 |FES1 |FUN12 |GAL11 |HFI1 |HOM6 |LEO1 |LGE1 |MORE
Reviews
Liu J, et al. (2009) Mechanochemical crosstalk during endocytic vesicle formation. Curr Opin Cell Biol
       |ACT1 |ARF1 |INP51 |INP52 |INP53 |INP54 |MYO1 |RVS161 |RVS167 |YMR1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Muthusamy BP, et al. (2009) Control of protein and sterol trafficking by antagonistic activities of a type IV P-type ATPase and oxysterol binding protein homologue. Mol Biol Cell 20(12):2920-31
       |CPS1 |DNF1 |DNF2 |DNF3 |DRS2 |ERG6 |GGA1 |GGA2 |KES1 |PHO8 |PRC1 |SNC1
Large-scale phenotype analysis
Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508
       |AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |MORE
Non-Fungal Related Genes/Proteins
Thorsen M, et al. (2009) Genetic basis of arsenite and cadmium tolerance in Saccharomyces cerevisiae. BMC Genomics 10:105
       |ACO1 |ADA2 |ADE8 |AKR1 |ARD1 |BIM1 |BRO1 |CCR4 |CHC1 |COQ6 |COX15 |CYS3 |DOA1 |ELM1 |MORE
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Wood CS, et al. (2009) PtdIns4P recognition by Vps74/GOLPH3 links PtdIns 4-kinase signaling to retrograde Golgi trafficking. J Cell Biol 187(7):967-75
       |FRQ1 |KRE2 |PIK1 |VPS74
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Yakir-Tamang L and Gerst JE (2009) A phosphatidylinositol-transfer protein and phosphatidylinositol-4-phosphate 5-kinase control Cdc42 to regulate the actin cytoskeleton and secretory pathway in yeast. Mol Biol Cell 20(15):3583-97
       |CDC24 |CDC42 |MSS4 |MYO2 |SEC1 |SEC12 |SEC14 |SEC15 |SEC2 |SEC22 |SEC3 |SEC4 |SEC8 |SEC9 |MORE
Function/Process
Mutants/Phenotypes
Abe F and Minegishi H (2008) Global screening of genes essential for growth in high-pressure and cold environments: searching for basic adaptive strategies using a yeast deletion library. Genetics 178(2):851-72
       |ACO1 |AGP1 |AGP2 |AGP3 |AKR1 |ALP1 |ARD1 |ARG82 |ARO1 |ARO2 |ATP15 |AVL9 |BAP2 |BAP3 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Baird D, et al. (2008) Assembly of the PtdIns 4-kinase Stt4 complex at the plasma membrane requires Ypp1 and Efr3. J Cell Biol 183(6):1061-74
       |EFR3 |STT4 |YPP1
DNA/RNA Sequence Features
Genetic Interactions
Mutants/Phenotypes
Regulation of
Strains/Constructs
Substrates/Ligands/Cofactors
Transcription
Knodler A, et al. (2008) Expression of yeast lipid phosphatase Sac1p is regulated by phosphatidylinositol-4-phosphate. BMC Mol Biol 9:16
       |OPI1 |PIK1 |STT4
Regulatory Role
Rubenstein EM, et al. (2008) Access Denied: Snf1 Activation Loop Phosphorylation Is Controlled by Availability of the Phosphorylated Threonine 210 to the PP1 Phosphatase. J Biol Chem 283(1):222-30
       |GLC7 |MIG1 |REG1 |SNF1 |TOS3
Cellular Location
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Faulhammer F, et al. (2007) Growth control of Golgi phosphoinositides by reciprocal localization of sac1 lipid phosphatase and pik1 4-kinase. Traffic 8(11):1554-67
             |DPM1 |FRQ1 |PIK1 |RER1 |SEC12 |SEC21 |SEC62
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Howe AG, et al. (2007) Regulation of Phosphoinositide Levels by the Phospholipid Transfer Protein Sec14p Controls Cdc42p/p21-Activated Kinase-Mediated Cell Cycle Progression at Cytokinesis. Eukaryot Cell 6(10):1814-23
       |ACT1 |ARK1 |CDC12 |CDC42 |CDC43 |CLA4 |CLB5 |GLC8 |KES1 |MSS4 |PIK1 |SEC14 |SEO1 |STE20 |MORE
Mutants/Phenotypes
Kramer RW, et al. (2007) Yeast functional genomic screens lead to identification of a role for a bacterial effector in innate immunity regulation. PLoS Pathog 3(2):e21
             |AFR1 |BMH1 |BNI1 |BNI4 |BRO1 |BUD22 |CCW12 |CDC10 |CDC26 |CNM67 |CWP1 |DAD3 |ECM33 |FIT2 |MORE
Mutants/Phenotypes
Strains/Constructs
Lockshon D, et al. (2007) The sensitivity of yeast mutants to oleic Acid implicates the peroxisome and other processes in membrane function. Genetics 175(1):77-91
       |ADO1 |ADR1 |AIM38 |AKR1 |ARP6 |ATG17 |AVL9 |BUD14 |BUD22 |BUD23 |BUD31 |CAR2 |CBS1 |CLA4 |MORE
Mutants/Phenotypes
Strains/Constructs
Pagani MA, et al. (2007) Disruption of iron homeostasis in Saccharomyces cerevisiae by high zinc levels: a genome-wide study. Mol Microbiol 65(2):521-37
       |ACO1 |ACO2 |ADE1 |ADE12 |ADE13 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADK1 |AFT1 |AKR1 |ARN1 |MORE
Reviews
Strahl T and Thorner J (2007) Synthesis and function of membrane phosphoinositides in budding yeast, Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):353-404
       |FAB1 |FIG4 |INP51 |INP52 |INP53 |INP54 |LSB6 |MSS4 |PIK1 |PLC1 |STT4 |VPS34 |YMR1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Wiradjaja F, et al. (2007) Inactivation of the phosphoinositide phosphatases Sac1p and Inp54p leads to accumulation of phosphatidylinositol 4,5-bisphosphate on vacuole membranes and vacuolar fusion defects. J Biol Chem 282(22):16295-307
         |INP54
Large-scale phenotype analysis
Yadav J, et al. (2007) A phenomics approach in yeast links proton and calcium pump function in the Golgi. Mol Biol Cell 18(4):1480-9
           |CUP5 |ERG2 |ERG3 |ERG4 |ERG6 |GAL11 |GCN4 |GCN5 |HFI1 |NHP10 |OPI1 |PMR1 |RPN4 |SET3 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Bobula J, et al. (2006) Why molecular chaperones buffer mutational damage: a case study with a yeast Hsp40/70 system. Genetics 174(2):937-44
       |ALG2 |ARC18 |CDC1 |GPI2 |NOP4 |RPB2 |RRP1 |RRP15 |SCH9 |SPE3 |TAF10 |TRK1 |VPS27 |ZUO1
Reviews
Griac P, et al. (2006) Phosphatidylinositol-transfer protein and its homologues in yeast. Biochem Soc Trans 34(Pt 3):377-80
       |AGE2 |CSR1 |GCS1 |KES1 |PDR16 |PDR17 |SEC14 |SFH5 |SPO14 |YKL091C
Protein-protein Interactions
Hardwidge PR, et al. (2006) Proteomic analysis of the binding partners to enteropathogenic Escherichia coli virulence proteins expressed in Saccharomyces cerevisiae. Proteomics 6(7):2174-9
       |ACT1 |ADE6 |AHP1 |APP1 |ARD1 |BCK1 |BOI1 |BUD2 |BUD8 |CHS3 |CRH1 |CSN12 |ELM1 |ENO1 |MORE
Reviews
Phillips SE, et al. (2006) The diverse biological functions of phosphatidylinositol transfer proteins in eukaryotes. Crit Rev Biochem Mol Biol 41(1):21-49
     |AGE2 |CKI1 |CPT1 |CSR1 |GCS1 |KES1 |PCT1 |PDR16 |PDR17 |SEC14 |SFH5 |YKL091C
Mutants/Phenotypes
Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401
       |AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Cellular Location
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
           |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Tabuchi M, et al. (2006) The phosphatidylinositol 4,5-biphosphate and TORC2 binding proteins Slm1 and Slm2 function in sphingolipid regulation. Mol Cell Biol 26(15):5861-75
             |AUR1 |BCK1 |CMP2 |CNB1 |CSG2 |FEN1 |GAS1 |GIM3 |INO2 |INO4 |ISC1 |KRE1 |LDB16 |MSS4 |MORE
Mutants/Phenotypes
Wagner MC, et al. (2006) Loss of the homotypic fusion and vacuole protein sorting or golgi-associated retrograde protein vesicle tethering complexes results in gentamicin sensitivity in the yeast Saccharomyces cerevisiae. Antimicrob Agents Chemother 50(2):587-95
         |CAX4 |CHC1 |CHS1 |GCS1 |MNN9 |NHX1 |PEP3 |PEP5 |RIB1 |SPS1 |SSZ1 |TLG2 |VPS15 |VPS16 |MORE
Cellular Location
Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50
         |AFG1 |AIM18 |ALD4 |ALO1 |ATP15 |ATP2 |ATP3 |ATP5 |AYR1 |BNA4 |CBR1 |CIR1 |COR1 |CYB2 |MORE
Reviews
Choudhury RR, et al. (2005) Phosphoinositides and membrane traffic at the trans-Golgi network. Biochem Soc Symp (72):31-8

Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Regulation of
Strains/Constructs
Faulhammer F, et al. (2005) Cell growth-dependent coordination of lipid signaling and glycosylation is mediated by interactions between Sac1p and Dpm1p. J Cell Biol 168(2):185-91
       |DPM1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Routt SM, et al. (2005) Nonclassical PITPs activate PLD via the Stt4p PtdIns-4-kinase and modulate function of late stages of exocytosis in vegetative yeast. Traffic 6(12):1157-72
           |CSR1 |LSB6 |MSS4 |PDR16 |PDR17 |PIK1 |PSD1 |SEC1 |SEC10 |SEC12 |SEC13 |SEC14 |SEC15 |SEC16 |MORE
Function/Process
Genetic Interactions
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Tahirovic S, et al. (2005) Regulation of intracellular phosphatidylinositol-4-phosphate by the Sac1 lipid phosphatase. Traffic 6(2):116-30
             |LSB6 |PIK1 |PTC1 |SLA2 |SNF7 |STT4 |VPS15 |VPS34
Mutants/Phenotypes
Regulatory Role
Zhang J, et al. (2005) The importance of being big. J Investig Dermatol Symp Proc 10(2):131-41
         |CDC28 |CLN1 |CLN2 |CLN3 |RPT2
Mutants/Phenotypes
Strains/Constructs
Novotna D, et al. (2004) Different action of killer toxins K1 and K2 on the plasma membrane and the cell wall of Saccharomyces cerevisiae. FEMS Yeast Res 4(8):803-13
       |ERG4 |GDA1 |KRE1 |KRE2 |VPS52 |VPS54
Genetic Interactions
Parrish WR, et al. (2004) Essential role for the myotubularin-related phosphatase Ymr1p and the synaptojanin-like phosphatases Sjl2p and Sjl3p in regulation of phosphatidylinositol 3-phosphate in yeast. Mol Biol Cell 15(8):3567-79
       |FIG4 |INP51 |INP52 |INP53 |LAP4 |VPS27 |YMR1
Genetic Interactions
Strains/Constructs
Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9
           |ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CAX4 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Roy A and Levine TP (2004) Multiple pools of phosphatidylinositol 4-phosphate detected using the pleckstrin homology domain of Osh2p. J Biol Chem 279(43):44683-9
       |OSH2 |SWH1
Mutants/Phenotypes
Viladevall L, et al. (2004) Characterization of the calcium-mediated response to alkaline stress in Saccharomyces cerevisiae. J Biol Chem 279(42):43614-24
               |CCH1 |CNB1 |CRZ1 |FMP43 |MID1 |VMA7 |YVC1
Mutants/Phenotypes
Blackburn AS and Avery SV (2003) Genome-wide screening of Saccharomyces cerevisiae to identify genes required for antibiotic insusceptibility of eukaryotes. Antimicrob Agents Chemother 47(2):676-81
         |ADH1 |CAX4 |CHC1 |CHS1 |ERG28 |GCS1 |MAC1 |MNN9 |PEP3 |PEP5 |RIB1 |SOD1 |SPS1 |VPS15 |MORE
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Despres B, et al. (2003) Three SAC1-like genes show overlapping patterns of expression in Arabidopsis but are remarkably silent during embryo development. Plant J 34(3):293-306

Non-Fungal Related Genes/Proteins
Rohde HM, et al. (2003) The human phosphatidylinositol phosphatase SAC1 interacts with the coatomer I complex. J Biol Chem 278(52):52689-99

Cellular Location
Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
         |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Tahirovic S, et al. (2003) Role for lipid signaling and the cell integrity MAP kinase cascade in yeast septum biogenesis. Curr Genet 43(2):71-8
       |CHS2 |CHS3 |SLT2
Function/Process
Mutants/Phenotypes
Strains/Constructs
Wenk MR, et al. (2003) Phosphoinositide profiling in complex lipid mixtures using electrospray ionization mass spectrometry. Nat Biotechnol 21(7):813-7
     |PIK1 |VPS34
Non-Fungal Related Genes/Proteins
Zhong R and Ye ZH (2003) The SAC domain-containing protein gene family in Arabidopsis. Plant Physiol 132(2):544-55
     |FIG4 |INP52 |INP53 |RSP5
Function/Process
Mutants/Phenotypes
Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53
       |ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE
Function/Process
Genetic Interactions
Gary JD, et al. (2002) Regulation of Fab1 phosphatidylinositol 3-phosphate 5-kinase pathway by Vac7 protein and Fig4, a polyphosphoinositide phosphatase family member. Mol Biol Cell 13(4):1238-51
       |FAB1 |FIG4 |VAC7
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Konrad G, et al. (2002) Retention of the yeast Sac1p phosphatase in the endoplasmic reticulum causes distinct changes in cellular phosphoinositide levels and stimulates microsomal ATP transport. J Biol Chem 277(12):10547-54

Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Li X, et al. (2002) Analysis of oxysterol binding protein homologue Kes1p function in regulation of Sec14p-dependent protein transport from the yeast Golgi complex. J Cell Biol 157(1):63-77
       |GCS1 |KES1 |PIK1 |SEC14 |STT4
Mutants/Phenotypes
Zhang J, et al. (2002) Genomic scale mutant hunt identifies cell size homeostasis genes in S. cerevisiae. Curr Biol 12(23):1992-2001
             |ACE2 |AIM26 |AKR1 |ALG13 |APN1 |ASF1 |BCK1 |BCK2 |CCR4 |CLN3 |ERM6 |FMC1 |GAL80 |GPB2 |MORE
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Foti M, et al. (2001) Sac1 lipid phosphatase and Stt4 phosphatidylinositol 4-kinase regulate a pool of phosphatidylinositol 4-phosphate that functions in the control of the actin cytoskeleton and vacuole morphology. Mol Biol Cell 12(8):2396-411
       |PIK1 |STT4
Reviews
Hughes WE (2001) The Sac phosphatase domain. Curr Biol 11(7):R249

Reviews
McMaster CR (2001) Lipid metabolism and vesicle trafficking: more than just greasing the transport machinery. Biochem Cell Biol 79(6):681-92
       |CHO2 |CKI1 |CPT1 |FAB1 |HNM1 |INO2 |INO4 |KES1 |MSS4 |OPI3 |PCT1 |PIK1 |SEC14 |SIT4 |MORE
Fungal Related Genes/Proteins
Protein Sequence Features
O'Malley CJ, et al. (2001) Mammalian inositol polyphosphate 5-phosphatase II can compensate for the absence of all three yeast Sac1-like-domain-containing 5-phosphatases. Biochem J 355(Pt 3):805-17
       |INP51 |INP52 |INP53 |INP54
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Schorr M, et al. (2001) The phosphoinositide phosphatase Sac1p controls trafficking of the yeast Chs3p chitin synthase. Curr Biol 11(18):1421-6
       |CHS3 |PIK1
Function/Process
Mutants/Phenotypes
Regulation of
Strains/Constructs
Hughes WE, et al. (2000) SAC1 encodes a regulated lipid phosphoinositide phosphatase, defects in which can be suppressed by the homologous Inp52p and Inp53p phosphatases. J Biol Chem 275(2):801-8
       |INP52 |INP53
Function/Process
Fungal Related Genes/Proteins
Protein Sequence Features
Reviews
Hughes WE, et al. (2000) Sac phosphatase domain proteins. Biochem J 350 Pt 2():337-52
       |FIG4 |INP51 |INP52 |INP53
Reviews
Huijbregts RP, et al. (2000) Lipid metabolism and regulation of membrane trafficking. Traffic 1(3):195-202
       |DRS2 |FAB1 |KES1 |PEP7 |PIK1 |SEC14 |SEC24 |VPS15 |VPS27 |VPS34
Reviews
Li X, et al. (2000) Phosphatidylinositol/phosphatidylcholine transfer proteins in yeast. Biochim Biophys Acta 1486(1):55-71
       |KES1 |SEC14
Cross-species Expression
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Nemoto Y, et al. (2000) Functional characterization of a mammalian Sac1 and mutants exhibiting substrate-specific defects in phosphoinositide phosphatase activity. J Biol Chem 275(44):34293-305

Reviews
Odorizzi G, et al. (2000) Phosphoinositide signaling and the regulation of membrane trafficking in yeast. Trends Biochem Sci 25(5):229-35
       |FAB1 |FIG4 |FRQ1 |INP51 |INP52 |INP53 |INP54 |MSS4 |PEP1 |PEP12 |PEP7 |PIB1 |PIB2 |PIK1 |MORE
Function/Process
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Regulatory Role
Guo S, et al. (1999) SAC1-like domains of yeast SAC1, INP52, and INP53 and of human synaptojanin encode polyphosphoinositide phosphatases. J Biol Chem 274(19):12990-5
       |INP51 |INP52 |INP53
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Hama H, et al. (1999) Direct involvement of phosphatidylinositol 4-phosphate in secretion in the yeast Saccharomyces cerevisiae. J Biol Chem 274(48):34294-300
       |PIK1 |SEC14 |STT4 |VPS34
Function/Process
Mutants/Phenotypes
Strains/Constructs
Hughes WE, et al. (1999) Mutations in the Saccharomyces cerevisiae gene SAC1 cause multiple drug sensitivity. Yeast 15(11):1111-24

Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Kochendorfer KU, et al. (1999) Sac1p plays a crucial role in microsomal ATP transport, which is distinct from its function in Golgi phospholipid metabolism. EMBO J 18(6):1506-15

Function/Process
Mutants/Phenotypes
Regulation of
Strains/Constructs
Rivas MP, et al. (1999) Pleiotropic alterations in lipid metabolism in yeast sac1 mutants: relationship to "bypass Sec14p" and inositol auxotrophy. Mol Biol Cell 10(7):2235-50
       |INO1 |PCT1 |SEC14 |SPO14
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Stock SD, et al. (1999) SEC14-dependent secretion in Saccharomyces cerevisiae. Nondependence on sphingolipid synthesis-coupled diacylglycerol production. J Biol Chem 274(19):12979-83
       |IPT1 |SEC14
Reviews
Dickson RC (1998) Sphingolipid functions in Saccharomyces cerevisiae: comparison to mammals. Annu Rev Biochem 67:27-48
       |CSG2 |DPL1 |IPT1 |LCB1 |LCB2 |LCB3 |SUR2
Fungal Related Genes/Proteins
Erdman S, et al. (1998) Pheromone-regulated genes required for yeast mating differentiation. J Cell Biol 140(3):461-83
       |FIG1 |FIG2 |FIG4 |KAR5 |PHD1
Fungal Related Genes/Proteins
Stolz LE, et al. (1998) INP51, a yeast inositol polyphosphate 5-phosphatase required for phosphatidylinositol 4,5-bisphosphate homeostasis and whose absence confers a cold-resistant phenotype. J Biol Chem 273(19):11852-61
       |INP51 |PLC1
Fungal Related Genes/Proteins
Stolz LE, et al. (1998) Identification and characterization of an essential family of inositol polyphosphate 5-phosphatases (INP51, INP52 and INP53 gene products) in the yeast Saccharomyces cerevisiae. Genetics 148(4):1715-29
       |INP51 |INP52 |INP53 |INP54
Function/Process
Mutants/Phenotypes
Strains/Constructs
Boyum R and Guidotti G (1997) Sac1p of Saccharomyces cerevisiae is not involved in ATP release to the extracellular fluid. Biochem Biophys Res Commun 236(1):50-3

Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Kearns BG, et al. (1997) Essential role for diacylglycerol in protein transport from the yeast Golgi complex. Nature 387(6628):101-5
     |SEC14 |SEC4
Reviews
Martin TF (1997) Protein transport. Greasing the Golgi budding machine. Nature 387(6628):21-2

Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Reisdorf P, et al. (1997) The MBR1 gene from Saccharomyces cerevisiae is activated by and required for growth under sub-optimal conditions. Mol Gen Genet 255(4):400-9
     |HAP2 |MBR1 |SCH9 |SOK1
Fungal Related Genes/Proteins
Srinivasan S, et al. (1997) Disruption of three phosphatidylinositol-polyphosphate 5-phosphatase genes from Saccharomyces cerevisiae results in pleiotropic abnormalities of vacuole morphology, cell shape, and osmohomeostasis. Eur J Cell Biol 74(4):350-60
     |ACT1 |INP51 |INP52 |INP53
Non-Fungal Related Genes/Proteins
Macreadie IG, et al. (1995) A domain of human immunodeficiency virus type 1 Vpr containing repeated H(S/F)RIG amino acid motifs causes cell growth arrest and structural defects. Proc Natl Acad Sci U S A 92(7):2770-4

Fungal Related Genes/Proteins
Maftahi M, et al. (1995) Sequencing analysis of a 15.4 kb fragment of yeast chromosome XIV identifies the RPD3, PAS8 and KRE1 loci, five new open reading frames. Yeast 11(6):567-72
     |CDC50 |KRE1 |PEX6 |RPD3
Function/Process
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Mayinger P, et al. (1995) Sac1p mediates the adenosine triphosphate transport into yeast endoplasmic reticulum that is required for protein translocation. J Cell Biol 131(6 Pt 1):1377-86

DNA/RNA Sequence Features
Mapping
Tzermia M, et al. (1994) The complete sequencing of a 24.6 kb segment of yeast chromosome XI identified the known loci URA1, SAC1 and TRP3, and revealed 6 new open reading frames including homologues to the threonine dehydratases, membrane transporters, hydantoinases and the phospholipase A2-activating protein. Yeast 10(5):663-79
     |JEN1 |TRP3 |URA1 |YCR007C
Mapping
Shen WC, et al. (1993) The Saccharomyces cerevisiae LOS1 gene involved in pre-tRNA splicing encodes a nuclear protein that behaves as a component of the nuclear matrix. J Biol Chem 268(26):19436-44
     |FAS1 |LOS1 |STE6 |TRP3 |UBA1 |URA1
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Whitters EA, et al. (1993) SAC1p is an integral membrane protein that influences the cellular requirement for phospholipid transfer protein function and inositol in yeast. J Cell Biol 122(1):79-94
     |ACT1 |SEC14
Reviews
Cleves A, et al. (1991) Phospholipid transfer proteins: a biological debut. Trends Cell Biol 1(1):30-4
       |SEC14
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Cleves AE, et al. (1989) Mutations in the SAC1 gene suppress defects in yeast Golgi and yeast actin function. J Cell Biol 109(6 Pt 1):2939-50
     |ACT1 |SEC14 |SEC6 |SEC9
DNA/RNA Sequence Features
Function/Process
Genetic Interactions
Mapping
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Novick P, et al. (1989) Suppressors of yeast actin mutations. Genetics 121(4):659-74
       |ACT1 |SAC3 |VPS52

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.