---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

MTR2/YKL186C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXI: 93303 to 92749 CDS: 93303 - 92749 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
MTR2	YKL186C		ORF, Verified	S000001669
Description
mRNA transport regulator, essential nuclear protein; Mex67p and Mtr2p form a mRNA export complex which binds to RNA

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By protein binding Strasser K, et al. (2000) Binding of the Mex67p/Mtr2p heterodimer to FXFG, GLFG, and FG repeat nucleoporins is essential for nuclear mRNA export. J Cell Biol 150(4):695-706        IDA : Inferred from Direct Assay Assigned on 2002-09-16 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT poly(A)+ mRNA export from nucleus Kadowaki T, et al. (1994) Nuclear mRNA accumulation causes nucleolar fragmentation in yeast mtr2 mutant. Mol Biol Cell 5(11):1253-63      IMP : Inferred from Mutant Phenotype Assigned on 2002-09-16 SGD Santos-Rosa H, et al. (1998) Nuclear mRNA export requires complex formation between Mex67p and Mtr2p at the nuclear pores. Mol Cell Biol 18(11):6826-38        IPI : Inferred from Physical Interaction IMP : Inferred from Mutant Phenotype Assigned on 2002-09-16 SGD ribosomal large subunit export from nucleus Yao W, et al. (2007) Nuclear Export of Ribosomal 60S Subunits by the General mRNA Export Receptor Mex67-Mtr2. Mol Cell 26(1):51-62        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction with SGD:NMD3 Assigned on 2007-08-01 SGD ribosomal subunit export from nucleus Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By nuclear RNA export factor complex Santos-Rosa H, et al. (1998) Nuclear mRNA export requires complex formation between Mex67p and Mtr2p at the nuclear pores. Mol Cell Biol 18(11):6826-38        IPI : Inferred from Physical Interaction with SGD:MEX67 Assigned on 2007-08-01 SGD nuclear pore Santos-Rosa H, et al. (1998) Nuclear mRNA export requires complex formation between Mex67p and Mtr2p at the nuclear pores. Mol Cell Biol 18(11):6826-38        IDA : Inferred from Direct Assay Assigned on 2002-09-16 SGD nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0191 Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forMTR2/YKL186C for MTR2 1) Kadowaki T, et al. (1994) Nuclear mRNA accumulation causes nucleolar fragmentation in yeast mtr2 mutant. Mol Biol Cell 5(11):1253-63      2) Kadowaki T, et al. (1994) Isolation and characterization of Saccharomyces cerevisiae mRNA transport-defective (mtr) mutants. J Cell Biol 126(3):649-59

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for MTR2/YKL186C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for MTR2/YKL186C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MNTNSNT C-term EDSLLKI Length(aa) 184 MW(Da) 20,783 pI 7.93 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.041   Codon Adaptation Index 0.112   Frequency of Optimal Codons 0.446   Hydropathicity of Protein -0.414   Aromaticity Score 0.092	10 20 30 40 50 | | | | | MNTNSNTMVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNC RIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNC KVRFDESGRDKMGQDATVPIQPNNTGNRNRPNDMNKPRPLWGPYFGISLQ LIIDDRIFRNDFNGVISGFNYNMVYKPEDSLLKI*

Protein Structures from PDB: proteins of known structure with sequence similarity to MTR2/YKL186C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to MTR2 Homolog Source (per PDB) Protein Alignment: MTR2 vs. Homolog External Links P-Value %Identical %Similar Alignment 1of5 ( Chain: B) Crystal structure of mex67-mtr2 PDB_Info PDB_Structure Saccharomyces cerevisiae 4.6e-91 100 0 View alignment SCOP MMDB CATH 1q40 ( Chain: A, C) Crystal structure of the c. albicans mtr2-mex67 m domain complex PDB_Info PDB_Structure Candida albicans Chain A = 5.3e-16 33 33 View alignment SCOP MMDB CATH Chain C = 5.3e-16 33 33 View alignment 1q42 ( Chain: A) Crystal structure analysis of the candida albicans mtr2 PDB_Info PDB_Structure Candida albicans 5.3e-16 33 33 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
MTR2	Kadowaki T, et al. (1994) Nuclear mRNA accumulation causes nucleolar fragmentation in yeast mtr2 mutant. Mol Biol Cell 5(11):1253-63      Kadowaki T, et al. (1994) Isolation and characterization of Saccharomyces cerevisiae mRNA transport-defective (mtr) mutants. J Cell Biol 126(3):649-59

Sequence Annotation Notes

Date	Note
2007-04-04	MTR2/YKL186C mRNA contains an intron in the 5' untranslated region (UTR); however, Miura et al. also detected an unspliced form that was more prevalent than the spliced version. Miura F, et al. (2006) A large-scale full-length cDNA analysis to explore the budding yeast transcriptome. Proc Natl Acad Sci U S A 103(47):17846-51

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YKL186C	SGD Systematic Sequence
853649	NCBI: Gene ID
NP_012735.1	NCBI: RefSeq protein version ID
NP_012735.1	NCBI: RefSeq protein version ID
6322662	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
47 curated references; 0 references not yet curated
Reviews	Fasken MB and Corbett AH (2009) Mechanisms of nuclear mRNA quality control. RNA Biol 6(3):237-41	|DIS3 |MEX67 |MLP1 |NAB2 |PAP2 |PML39 |RRP6 |SUB2 |YRA1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Faza MB, et al. (2009) Sem1 is a functional component of the nuclear pore complex-associated messenger RNA export machinery. J Cell Biol 184(6):833-46	|CSN12 |MEX67 |SAC3 |SEM1 |SUB2 |SUS1 |THP1 |YPR045C |YRA1
RNA Levels and Processing Regulation of	Kawashima T, et al. (2009) Nonsense-mediated mRNA decay mutes the splicing defects of spliceosome component mutations. RNA 15(12):2236-47	|ACT1 |BOS1 |CDC40 |CIN2 |LSB3 |MUD1 |NAM7 |NAM8 |PRP18 |PRP2 |PRP22 |REC107 |RPL16A |RPS11B |MORE
Reviews	Kressler D, et al. (2009) Driving Ribosome Assembly. Biochim Biophys Acta	|AFG2 |ARB1 |ARX1 |BMS1 |CRM1 |DBP10 |DBP2 |DBP3 |DBP6 |DBP7 |DBP8 |DBP9 |DRS1 |ECM1 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Lo KY and Johnson AW (2009) Reengineering ribosome export. Mol Biol Cell 20(5):1545-54	|ARX1 |CRM1 |CSE1 |LOS1 |LSG1 |MEX67 |MSN5 |NMD3 |RPL11B |RPL12B |RPL25 |RPL3 |RPL32 |RPL8B
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Reviews	Feldbrugge M, et al. (2008) The posttranscriptional machinery of Ustilago maydis. Fungal Genet Biol 45 Suppl 1:S40-6	|ACT1 |ASH1 |DBP5 |GLE1 |KEM1 |MEX67 |MYO4 |NAM7 |NIP1 |NMD2 |NOP58 |PRT1 |RPG1 |SHE2 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hung NJ, et al. (2008) Arx1 Is a Nuclear Export Receptor for the 60S Ribosomal Subunit in Yeast. Mol Biol Cell 19(2):735-44	|ARX1 |CRM1 |GLE2 |MEX67 |NIC96 |NMD3 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP42 |NUP57 |NUP82 |MORE
Reviews	Hurt JA and Silver PA (2008) mRNA nuclear export and human disease. Dis Model Mech 1(2-3):103-8	|DBP5 |GLE1 |MEX67 |NUP42 |SUB2 |YRA1
Computational analysis Evolution Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Ohyanagi H, et al. (2008) Eukaryotic nuclear structure explains the evolutionary rate difference of ribosome export factors. Gene 421(1-2):7-13	|CRM1 |MAK21 |NMD3 |NOC2 |NOC3 |NOC4 |NOP14
Evolution Non-Fungal Related Genes/Proteins	Ohyanagi H, et al. (2008) The origin of nucleus: Rebuild from the prokaryotic ancestors of ribosome export factors. Gene 423(2):149-152	|CRM1 |MAK21 |NMD3 |NOC2 |NOC3 |NOC4 |NOP14
DNA/RNA Sequence Features Mutants/Phenotypes Strains/Constructs	Parenteau J, et al. (2008) Deletion of Many Yeast Introns Reveals a Minority of Genes that Require Splicing for Function. Mol Biol Cell 19(5):1932-41	|ACT1 |ARP2 |ARP9 |BUD25 |CIN2 |COF1 |DYN2 |GIM5 |GLC7 |HNT1 |HOP2 |LSB3 |MOB1 |MOB2 |MORE
Reviews	Rougemaille M, et al. (2008) mRNA journey to the cytoplasm: attire required. Biol Cell 100(6):327-42	|CBC2 |CDC33 |HRB1 |MEX67 |NAB2 |NPL3 |PAB1 |SAC3 |STO1 |SUB2 |THP1 |YRA1
Mutants/Phenotypes Protein Sequence Features Protein-Nucleic Acid Interactions Protein-protein Interactions Strains/Constructs	Yao W, et al. (2008) A versatile interaction platform on the Mex67-Mtr2 receptor creates an overlap between mRNA and ribosome export. EMBO J 27(1):6-16	|MEX67 |NMD3 |NUP116 |NUP120 |NUP145 |NUP159 |NUP82 |NUP84 |NUP85 |SEC13 |SEH1
Function/Process	Gaillard H, et al. (2007) A new connection of mRNP biogenesis and export with transcription-coupled repair. Nucleic Acids Res 35(12):3893-906	|DEF1 |FMP27 |HPR1 |MEX67 |MFT1 |RAD26 |RAD7 |RPB10 |RPB11 |RPB2 |RPB3 |RPB4 |RPB5 |RPB7 |MORE
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |NMD3 |MORE
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Reviews	Stewart M (2007) Ratcheting mRNA out of the Nucleus. Mol Cell 25(3):327-30	|DBP5 |GLE1 |MEX67
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-Nucleic Acid Interactions Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Yao W, et al. (2007) Nuclear Export of Ribosomal 60S Subunits by the General mRNA Export Receptor Mex67-Mtr2. Mol Cell 26(1):51-62	|MEX67 |NMD3
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Protein Physical Properties Protein-protein Interactions Strains/Constructs	Gwizdek C, et al. (2006) Ubiquitin-associated domain of Mex67 synchronizes recruitment of the mRNA export machinery with transcription. Proc Natl Acad Sci U S A 103(44):16376-81	|GAL10 |HPR1 |MEX67 |MFT1 |PMA1 |RAD23 |RSP5 |THP2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Panse VG, et al. (2006) Formation and nuclear export of preribosomes are functionally linked to the small-ubiquitin-related modifier pathway. Traffic 7(10):1311-21	|ARX1 |BUD20 |CIC1 |ECM1 |ENP1 |LSG1 |MEX67 |NOP14 |NOP7 |NSA1 |NUG1 |PWP2 |RIX1 |RIX7 |MORE
Reviews	Izaurralde E (2004) Directing mRNA export. Nat Struct Mol Biol 11(3):210-2	|MEX67 |NPL3 |SKY1
Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure	Fribourg S and Conti E (2003) Structural similarity in the absence of sequence homology of the messenger RNA export factors Mtr2 and p15. EMBO Rep 4(7):699-703	|MEX67 |NTF2
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Lei EP, et al. (2003) Sac3 is an mRNA export factor that localizes to cytoplasmic fibrils of nuclear pore complex. Mol Biol Cell 14(3):836-47	|MEX67 |SAC3
Fungal Related Genes/Proteins	Senay C, et al. (2003) The Mtr2-Mex67 NTF2-like domain complex. Structural insights into a dual role of Mtr2 for yeast nuclear export. J Biol Chem 278(48):48395-403	|MEX67 |NTF2
Function/Process Protein-protein Interactions	Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52	|MEX67 |NUP1 |SAC3 |SUB2 |THP1 |YRA1
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Jimeno S, et al. (2002) The yeast THO complex and mRNA export factors link RNA metabolism with transcription and genome instability. EMBO J 21(13):3526-35	|HPR1 |MEX67 |MFT1 |SUB2 |THO2 |THP2 |YRA1
Function/Process Protein-protein Interactions	Nissan TA, et al. (2002) 60S pre-ribosome formation viewed from assembly in the nucleolus until export to the cytoplasm. EMBO J 21(20):5539-47	|ARX1 |LSG1 |MDN1 |NMD3 |NOP7 |NUG1 |RIX1 |SDA1
Function/Process Substrates/Ligands/Cofactors	Jensen TH, et al. (2001) A block to mRNA nuclear export in S. cerevisiae leads to hyperadenylation of transcripts that accumulate at the site of transcription. Mol Cell 7(4):887-98	|DBP5 |GLE1 |HSP104 |MEX67 |NUP159 |NUP42 |SSA4
Cellular Location Protein-protein Interactions	Strasser K and Hurt E (2001) Splicing factor Sub2p is required for nuclear mRNA export through its interaction with Yra1p. Nature 413(6856):648-52	|MEX67 |SUB2 |YRA1
Cellular Location Function/Process Strains/Constructs	Strawn LA, et al. (2001) The GLFG regions of Nup116p and Nup100p serve as binding sites for both Kap95p and Mex67p at the nuclear pore complex. J Biol Chem 276(9):6445-52	|DBP5 |GLE1 |GLE2 |KAP95 |MEX67 |NUP100 |NUP116
Fungal Related Genes/Proteins RNA Levels and Processing	Davis CA, et al. (2000) Test of intron predictions reveals novel splice sites, alternatively spliced mRNAs and new introns in meiotically regulated genes of yeast. Nucleic Acids Res 28(8):1700-6	|AIM11 |AMA1 |AML1 |APE2 |APS3 |ARP9 |ASC1 |BET1 |BIG1 |BOS1 |CDC21 |COF1 |DCN1 |DID4 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89	|CRM1 |CSE1 |DBP5 |FAL1 |GLE1 |GLE2 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR4 |MORE
Protein-Nucleic Acid Interactions Protein-protein Interactions Techniques and Reagents	Strasser K and Hurt E (2000) Yra1p, a conserved nuclear RNA-binding protein, interacts directly with Mex67p and is required for mRNA export. EMBO J 19(3):410-20	|MEX67 |YRA1
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Strasser K, et al. (2000) Binding of the Mex67p/Mtr2p heterodimer to FXFG, GLFG, and FG repeat nucleoporins is essential for nuclear mRNA export. J Cell Biol 150(4):695-706	|GLE2 |MEX67 |NSP1 |NUP116 |NUP159 |NUP42
Function/Process Mutants/Phenotypes Strains/Constructs	Vainberg IE, et al. (2000) Nuclear export of heat shock and non-heat-shock mRNA occurs via similar pathways. Mol Cell Biol 20(11):3996-4005	|GLE1 |NUP159 |NUP42 |RNA1 |SRM1
Non-Fungal Related Genes/Proteins	Katahira J, et al. (1999) The Mex67p-mediated nuclear mRNA export pathway is conserved from yeast to human. EMBO J 18(9):2593-609	|MEX67 |NTF2
Reviews	Strasser K and Hurt E (1999) Nuclear RNA export in yeast. FEBS Lett 452(1-2):77-81	|GLE1 |MEX67 |MTR10 |NPL3 |NSP1 |NUP120 |NUP145 |NUP159 |NUP82 |NUP85
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Santos-Rosa H, et al. (1998) Nuclear mRNA export requires complex formation between Mex67p and Mtr2p at the nuclear pores. Mol Cell Biol 18(11):6826-38	|MEX67 |NUP85
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR3 |MTR4 |MORE
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Function/Process Fungal Related Genes/Proteins Reviews	Schneiter R, et al. (1995) mRNA transport in yeast: time to reinvestigate the functions of the nucleolus. Mol Biol Cell 6(4):357-70	|NPL3 |NUP116 |NUP145 |NUP49 |RNA14
Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Kadowaki T, et al. (1994) Isolation and characterization of Saccharomyces cerevisiae mRNA transport-defective (mtr) mutants. J Cell Biol 126(3):649-59	|ACC1 |MTR10 |MTR3 |MTR4 |NPL3 |SRM1
DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Kadowaki T, et al. (1994) Nuclear mRNA accumulation causes nucleolar fragmentation in yeast mtr2 mutant. Mol Biol Cell 5(11):1253-63
DNA/RNA Sequence Features Mapping Strains/Constructs	Wiemann S, et al. (1993) Sequencing and analysis of 51.6 kilobases on the left arm of chromosome XI from Saccharomyces cerevisiae reveals 23 open reading frames including the FAS1 gene. Yeast 9(12):1343-8	|FAS1

Return to SGD

Send a Message to the SGD Curators