---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SRP102/YKL154W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXI: 161606 to 162340 CDS: 161606 - 162340 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SRP102	YKL154W		ORF, Verified	S000001637
Description
Signal recognition particle (SRP) receptor beta subunit; involved in SRP-dependent protein targeting; anchors Srp101p to the ER membrane

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By GTP binding Miller JD, et al. (1995) The beta subunit of the signal recognition particle receptor is a transmembrane GTPase that anchors the alpha subunit, a peripheral membrane GTPase, to the endoplasmic reticulum membrane. J Cell Biol 128(3):273-82        IPI : Inferred from Physical Interaction Assigned on 2005-01-28 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0342 Assigned on 2007-05-23 UniProtKB GTPase activity Miller JD, et al. (1995) The beta subunit of the signal recognition particle receptor is a transmembrane GTPase that anchors the alpha subunit, a peripheral membrane GTPase, to the endoplasmic reticulum membrane. J Cell Biol 128(3):273-82        ISS : Inferred from Sequence or structural Similarity with GenBank/EMBL/DDBJ:AAA35552.1 Assigned on 2005-01-28 SGD nucleotide binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0547 Assigned on 2007-05-23 UniProtKB receptor activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0675 Assigned on 2007-05-23 UniProtKB signal recognition particle binding Ogg SC, et al. (1998) A functional GTPase domain, but not its transmembrane domain, is required for function of the SRP receptor beta-subunit. J Cell Biol 142(2):341-54        IMP : Inferred from Mutant Phenotype ISS : Inferred from Sequence or structural Similarity IPI : Inferred from Physical Interaction Assigned on 2002-08-22 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By SRP-dependent cotranslational protein targeting to membrane Miller JD, et al. (1995) The beta subunit of the signal recognition particle receptor is a transmembrane GTPase that anchors the alpha subunit, a peripheral membrane GTPase, to the endoplasmic reticulum membrane. J Cell Biol 128(3):273-82        TAS : Traceable Author Statement IC : Inferred By Curator from signal recognition particle receptor complex Assigned on 2005-01-28 SGD protein targeting to ER Ogg SC, et al. (1998) A functional GTPase domain, but not its transmembrane domain, is required for function of the SRP receptor beta-subunit. J Cell Biol 142(2):341-54        IMP : Inferred from Mutant Phenotype Assigned on 2002-08-22 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB endoplasmic reticulum membrane GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0097 Assigned on 2008-02-13 UniProtKB integral to endoplasmic reticulum membrane Ogg SC, et al. (1998) A functional GTPase domain, but not its transmembrane domain, is required for function of the SRP receptor beta-subunit. J Cell Biol 142(2):341-54        IDA : Inferred from Direct Assay Assigned on 2002-08-22 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB ribonucleoprotein complex GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0687 Assigned on 2007-05-23 UniProtKB signal recognition particle receptor complex Ogg SC, et al. (1998) A functional GTPase domain, but not its transmembrane domain, is required for function of the SRP receptor beta-subunit. J Cell Biol 142(2):341-54        TAS : Traceable Author Statement Assigned on 2005-01-24 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forSRP102/YKL154W for SRP102 1) Ogg SC, et al. (1998) A functional GTPase domain, but not its transmembrane domain, is required for function of the SRP receptor beta-subunit. J Cell Biol 142(2):341-54

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SRP102/YKL154W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SRP102/YKL154W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MLSNTLI C-term EWIDEKL Length(aa) 244 MW(Da) 26,974 pI 7.89 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.069   Codon Adaptation Index 0.141   Frequency of Optimal Codons 0.454   Hydropathicity of Protein -0.114   Aromaticity Score 0.061	10 20 30 40 50 | | | | | MLSNTLIIACLLVIGTTIALIAVQKASSKTGIKQKSYQPSIIIAGPQNSG KTSLLTLLTTDSVRPTVVSQEPLSAADYDGSGVTLVDFPGHVKLRYKLSD YLKTRAKFVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESSCENGIDIL IACNKSELFTARPPSKIKDALESEIQKVIERRKKSLNEVERKINEEDYAE NTLDVLQSTDGFKFANLEASVVAFEGSINKRKISQWREWIDEKL*

Protein Structures from PDB: proteins of known structure with sequence similarity to SRP102/YKL154W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to SRP102 Homolog Source (per PDB) Protein Alignment: SRP102 vs. Homolog External Links P-Value %Identical %Similar Alignment 1nrj ( Chain: B) Signal recognition particle receptor beta-subunit in complex with the srx domain from the alpha-subunit PDB_Info PDB_Structure Saccharomyces cerevisiae 1.1e-90 99 1 View alignment SCOP MMDB CATH 2ged ( Chain: A, B) Signal recognition particle receptor beta-subunit in nucleotide-free dimerized form PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 6.5e-60 100 0 View alignment SCOP MMDB CATH Chain B = 6.5e-60 100 0 View alignment 2go5 ( Chain: 2) Structure of signal recognition particle receptor (sr) in complex with signal recognition particle (srp) and ribosome nascent chain complex PDB_Info PDB_Structure Canis sp. | Triticum sp. | Homo sapiens | Mus musculus 1.0e-11 29 34 View alignment SCOP MMDB CATH 2fh5 ( Chain: B) The structure of the mammalian srp receptor PDB_Info PDB_Structure Homo sapiens | Mus musculus 1.0e-11 29 34 View alignment SCOP MMDB CATH 3bh7 ( Chain: A) Crystal structure of the rp2-arl3 complex bound to gdp-alf4 PDB_Info PDB_Structure Mus musculus | Homo sapiens 5.7e-05 29 36 View alignment SCOP MMDB CATH 1fzq ( Chain: A) Crystal structure of murine arl3-gdp PDB_Info PDB_Structure Mus musculus 6.3e-05 29 36 View alignment SCOP MMDB CATH 3bh6 ( Chain: A) Crystal structure of the rp2-arl3 complex bound to gppnhp PDB_Info PDB_Structure Mus musculus | Homo sapiens 0.000110 30 35 View alignment SCOP MMDB CATH 2fmx ( Chain: A, B) An open conformation of switch i revealed by sar1-gdp crystal structure at low mg(2+) PDB_Info PDB_Structure Cricetulus griseus Chain A = 0.001200 31 26 View alignment SCOP MMDB CATH Chain B = 0.001200 31 26 View alignment 1f6b ( Chain: B, A) Crystal structure of sar1-gdp complex PDB_Info PDB_Structure Cricetulus griseus Chain B = 0.001200 31 26 View alignment SCOP MMDB CATH Chain A = 0.001200 31 26 View alignment 2qtv ( Chain: B) Structure of sec23-sar1 complexed with the active fragment of sec31 PDB_Info PDB_Structure Saccharomyces cerevisiae 0.005200 27 31 View alignment SCOP MMDB CATH 1m2o ( Chain: D, B) Crystal structure of the sec23-sar1 complex PDB_Info PDB_Structure Saccharomyces cerevisiae Chain D = 0.006102 27 31 View alignment SCOP MMDB CATH Chain B = 0.006102 27 31 View alignment 2gao ( Chain: B, A) Crystal structure of human sar1a in complex with gdp PDB_Info PDB_Structure Homo sapiens Chain B = 0.008099 26 29 View alignment SCOP MMDB CATH Chain A = 0.008099 26 29 View alignment 2fa9 ( Chain: B, A) The crystal structure of sar1[h79g]-gdp provides insight into the coat-controlled gtp hydrolysis in the disassembly of cop ii PDB_Info PDB_Structure Cricetulus griseus Chain B = 0.008497 30 26 View alignment SCOP MMDB CATH Chain A = 0.008497 30 26 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SRP102	Ogg SC, et al. (1998) A functional GTPase domain, but not its transmembrane domain, is required for function of the SRP receptor beta-subunit. J Cell Biol 142(2):341-54

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YKL154W	SGD Systematic Sequence
853702	NCBI: Gene ID
NP_012768.1	NCBI: RefSeq protein version ID
NP_012768.1	NCBI: RefSeq protein version ID
6322695	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
10 curated references; 0 references not yet curated
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Jiang Y, et al. (2008) An interaction between the SRP receptor and the translocon is critical during cotranslational protein translocation. J Cell Biol 180(6):1149-61	|SBH1 |SBH2 |SEC61 |SRP101 |SSH1 |SSS1
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Alias Protein/Nucleic Acid Structure	Schlenker O, et al. (2006) The structure of the mammalian signal recognition particle (SRP) receptor as prototype for the interaction of small GTPases with Longin domains. J Biol Chem 281(13):8898-906	|ARF1 |SAR1 |SRP101 |YKT6
Function/Process Mutants/Phenotypes Strains/Constructs	Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7	|ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG1 |ERG10 |ERG12 |ERG13 |MORE
Protein-protein Interactions	Miller JP, et al. (2005) Large-scale identification of yeast integral membrane protein interactions. Proc Natl Acad Sci U S A 102(34):12123-8	|ARV1 |EMP24 |EMP46 |EMP47 |ERD1 |ERD2 |ERG11 |ERP5 |ERV29 |ERV41 |MST27 |PHO84 |PHO88 |SEC61 |MORE
Mutants/Phenotypes Strains/Constructs	Vandenbol M and Fairhead C (2000) Mass-murder deletion of 19 ORFs from Saccharomyces cerevisiae chromosome XI. Gene 247(1-2):45-52	|APE2 |AVT3 |EBP2 |ELF1 |KKQ8 |MCD4 |MCR1 |RCN1 |RPS27A |RSM22 |SNU114 |TPO5 |YKL147C |YKL151C |MORE
Cellular Location Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions Strains/Constructs	Ogg SC, et al. (1998) A functional GTPase domain, but not its transmembrane domain, is required for function of the SRP receptor beta-subunit. J Cell Biol 142(2):341-54	|KAR2 |SRP101 |SRP54
Non-Fungal Related Genes/Proteins	Miller JD, et al. (1995) The beta subunit of the signal recognition particle receptor is a transmembrane GTPase that anchors the alpha subunit, a peripheral membrane GTPase, to the endoplasmic reticulum membrane. J Cell Biol 128(3):273-82
Fungal Related Genes/Proteins	Ogg SC, et al. (1992) Signal recognition particle receptor is important for cell growth and protein secretion in Saccharomyces cerevisiae. Mol Biol Cell 3(8):895-911	|SCR1 |SRP101

Return to SGD

Send a Message to the SGD Curators