---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

LHS1/YKL073W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXI: 296074 to 298719 CDS: 296074 - 298719 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
LHS1	YKL073W	CER1, SSI1	ORF, Verified	S000001556
Description
Molecular chaperone of the endoplasmic reticulum lumen, involved in polypeptide translocation and folding; nucleotide exchange factor for the ER lumenal Hsp70 chaperone Kar2p; regulated by the unfolded protein response pathway

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By ATP binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001023 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0067 Assigned on 2007-05-23 UniProtKB de Keyzer J, et al. (2009) Nucleotide binding by Lhs1p is essential for its nucleotide exchange activity and for function in vivo. J Biol Chem 284(46):31564-71        IMP : Inferred from Mutant Phenotype IDA : Inferred from Direct Assay Assigned on 2009-09-24 SGD ATPase activity Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc ATPase activity, uncoupled GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:3.6.1.3 Assigned on 2009-01-12 UniProtKB adenyl-nucleotide exchange factor activity Steel GJ, et al. (2004) Coordinated activation of Hsp70 chaperones. Science 303(5654):98-101        IDA : Inferred from Direct Assay Assigned on 2009-09-24 SGD hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2009-01-12 UniProtKB nucleotide binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0547 Assigned on 2007-05-23 UniProtKB unfolded protein binding Baxter BK, et al. (1996) SSI1 encodes a novel Hsp70 of the Saccharomyces cerevisiae endoplasmic reticulum. Mol Cell Biol 16(11):6444-56        ISS : Inferred from Sequence or structural Similarity IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction Assigned on 2002-06-18 SGD Hamilton TG, et al. (1999) Cer1p functions as a molecular chaperone in the endoplasmic reticulum of Saccharomyces cerevisiae. Mol Cell Biol 19(8):5298-307        ISS : Inferred from Sequence or structural Similarity IMP : Inferred from Mutant Phenotype IPI : Inferred from Physical Interaction Assigned on 2002-06-18 SGD Craven RA, et al. (1996) A novel Hsp70 of the yeast ER lumen is required for the efficient translocation of a number of protein precursors. EMBO J 15(11):2640-50      ISS : Inferred from Sequence or structural Similarity IGI : Inferred from Genetic Interaction IMP : Inferred from Mutant Phenotype Assigned on 2002-06-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By ER-nuclear signaling pathway Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular response to heat Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439        RCA : Reviewed Computational Analysis Assigned on 2009-03-03 SGD protein transport Hamilton TG and Flynn GC (1996) Cer1p, a novel Hsp70-related protein required for posttranslational endoplasmic reticulum translocation in yeast. J Biol Chem 271(48):30610-3        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction Assigned on 2002-06-18 SGD response to unfolded protein Baxter BK, et al. (1996) SSI1 encodes a novel Hsp70 of the Saccharomyces cerevisiae endoplasmic reticulum. Mol Cell Biol 16(11):6444-56        IGI : Inferred from Genetic Interaction IMP : Inferred from Mutant Phenotype Assigned on 2002-06-18 SGD Craven RA, et al. (1996) A novel Hsp70 of the yeast ER lumen is required for the efficient translocation of a number of protein precursors. EMBO J 15(11):2640-50      IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction Assigned on 2002-06-18 SGD Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2009-10-01 UniProtKB endoplasmic reticulum lumen Craven RA, et al. (1996) A novel Hsp70 of the yeast ER lumen is required for the efficient translocation of a number of protein precursors. EMBO J 15(11):2640-50      IDA : Inferred from Direct Assay ISS : Inferred from Sequence or structural Similarity Assigned on 2003-07-30 SGD Tyson JR and Stirling CJ (2000) LHS1 and SIL1 provide a lumenal function that is essential for protein translocation into the endoplasmic reticulum. EMBO J 19(23):6440-52          TAS : Traceable Author Statement Assigned on 2003-07-30 SGD GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0096 Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for LHS1/YKL073W for LHS1 LHS1 encodes a non-essential protein with sequence similarity to the HSP70 family of molecular chaperones (1). HSP70 is a large family of proteins that has been evolutionarily conserved from bacteria (DnaK) to humans (HSP72/73). HSP70 proteins were originally classified based upon their induction by heat shock and their size of ~70kDa (reviewed in 2). S. cerevisiae has at least 9 cytosolic forms of HSP70 (encoded by SSA1, SSA2, SSA3, SSA4, SSB1, SSB2, SSE1, SSE2, SSZ1), 2 HSP70s which are found in the endoplasmic reticulum (KAR2, LHS1), and 3 mitochondrial HSP70 proteins (SSC1, SSQ1, ECM10). Lhs1p localizes to the ER and shares 24% amino acid identity with the other ER HSP70 protein, Kar2p (3). These two proteins reciprocally regulate each other; the ATPase activity of Lhs1p is stimulated by Kar2p and Lhs1p enhances the rate of Kar2p ATP turnover by providing specific nucleotide exchange (4). While Kar2p is involved in both co- and post-translational targeting of proteins into the ER, Lhs1p only participates in post-translational import (5). In addition, Lhs1p activity also affects the refolding and stability of heat-denatured proteins (6). LHS1 expression is induced by the drug tunicamycin and also by conditions that lead to the accumulation of unfolded proteins and triggering of the Unfolded Protein Response (UPR) (3, 7). Upregulation of LHS1 expression during UPR is mediated by the transcriptional activator Hac1p, which binds a 22 base pair UPR element, containing the consensus sequence 5'-CAGCGTG-3', present in the LHS1 promoter (8, 3). lhs1 null mutations result in cold sensitivity, enhanced resistance to manganese, a partial block in ER protein translocation, and constitutive activation of UPR (3, 7). Last Updated: 2006-02-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forLHS1/YKL073W for LHS1 1) Hallstrom TC, et al. (1998) Regulation of transcription factor Pdr1p function by an Hsp70 protein in Saccharomyces cerevisiae. Mol Cell Biol 18(3):1147-55        2) Bukau B and Horwich AL (1998) The Hsp70 and Hsp60 chaperone machines. Cell 92(3):351-66        3) Baxter BK, et al. (1996) SSI1 encodes a novel Hsp70 of the Saccharomyces cerevisiae endoplasmic reticulum. Mol Cell Biol 16(11):6444-56        4) Steel GJ, et al. (2004) Coordinated activation of Hsp70 chaperones. Science 303(5654):98-101        5) Hamilton TG and Flynn GC (1996) Cer1p, a novel Hsp70-related protein required for posttranslational endoplasmic reticulum translocation in yeast. J Biol Chem 271(48):30610-3        6) Saris N, et al. (1997) The Hsp70 homologue Lhs1p is involved in a novel function of the yeast endoplasmic reticulum, refolding and stabilization of heat-denatured protein aggregates. J Cell Biol 137(4):813-24        7) Craven RA, et al. (1996) A novel Hsp70 of the yeast ER lumen is required for the efficient translocation of a number of protein precursors. EMBO J 15(11):2640-50      8) Mori K, et al. (1998) Palindrome with spacer of one nucleotide is characteristic of the cis-acting unfolded protein response element in Saccharomyces cerevisiae. J Biol Chem 273(16):9912-20

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for LHS1/YKL073W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for LHS1/YKL073W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MRNVLRL C-term DILHDEL Length(aa) 881 MW(Da) 99,571 pI 5.04 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.069   Codon Adaptation Index 0.147   Frequency of Optimal Codons 0.454   Hydropathicity of Protein -0.453   Aromaticity Score 0.073

10 20 30 40 50 | | | | | MRNVLRLLFLTAFVAIGSLAAVLGVDYGQQNIKAIVVSPQAPLELVLTPE AKRKEISGLSIKRLPGYGKDDPNGIERIYGSAVGSLATRFPQNTLLHLKP LLGKSLEDETTVTLYSKQHPGLEMVSTNRSTIAFLVDNVEYPLEELVAMN VQEIANRANSLLKDRDARTEDFVNKMSFTIPDFFDQHQRKALLDASSITT GIEETYLVSEGMSVAVNFVLKQRQFPPGEQQHYIVYDMGSGSIKASMFSI LQPEDTTQPVTIEFEGYGYNPHLGGAKFTMDIGSLIENKFLETHPAIRTD ELHANPKALAKINQAAEKAKLILSANSEASINIESLINDIDFRTSITRQE FEEFIADSLLDIVKPINDAVTKQFGGYGTNLPEINGVILAGGSSRIPIVQ DQLIKLVSEEKVLRNVNADESAVNGVVMRGIKLSNSFKTKPLNVVDRSVN TYSFKLSNESELYDVFTRGSAYPNKTSILTNTTDSIPNNFTIDLFENGKL FETITVNSGAIKNSYSSDKCSSGVAYNITFDLSSDRLFSIQEVNCICQSE NDIGNSKQIKNKGSRLAFTSEDVEIKRLSPSERSRLHEHIKLLDKQDKER FQFQENLNVLESNLYDARNLLMDDEVMQNGPKSQVEELSEMVKVYLDWLE DASFDTDPEDIVSRIREIGILKKKIELYMDSAKEPLNSQQFKGMLEEGHK LLQAIETHKNTVEEFLSQFETEFADTIDNVREEFKKIKQPAYVSKALSTW EETLTSFKNSISEIEKFLAKNLFGEDLREHLFEIKLQFDMYRTKLEEKLR LIKSGDESRLNEIKKLHLRNFRLQKRKEEKLKRKLEQEKSRNNNETESTV INSADDKTTIVNDKTTESNPSSEEDILHDEL*

Protein Structures from PDB: proteins of known structure with sequence similarity to LHS1/YKL073W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to LHS1 Homolog Source (per PDB) Protein Alignment: LHS1 vs. Homolog External Links P-Value %Identical %Similar Alignment 3c7n ( Chain: B, A) Structure of the hsp110:hsc70 nucleotide exchange complex PDB_Info PDB_Structure Saccharomyces cerevisiae | Bos taurus Chain B = 2.5e-23 24 36 View alignment SCOP MMDB CATH Chain A = 1.1e-21 22 33 View alignment 1yuw ( Chain: A) Crystal structure of bovine hsc70(aa1-554)e213a/d214a mutant PDB_Info PDB_Structure Bos taurus 6.7e-23 24 36 View alignment SCOP MMDB CATH 3d2f ( Chain: A, C, B, D) Crystal structure of a complex of sse1p and hsp70 PDB_Info PDB_Structure Saccharomyces cerevisiae | Homo sapiens Chain A = 1.1e-22 23 32 View alignment SCOP MMDB CATH Chain C = 1.1e-22 23 32 View alignment Chain B = 1.8e-18 26 34 View alignment Chain D = 1.8e-18 26 34 View alignment 3d2e ( Chain: A, C, B, D) Crystal structure of a complex of sse1p and hsp70, selenomethionine-labeled crystals PDB_Info PDB_Structure Saccharomyces cerevisiae | Homo sapiens Chain A = 1.1e-22 23 32 View alignment SCOP MMDB CATH Chain C = 1.1e-22 23 32 View alignment Chain B = 1.8e-18 26 34 View alignment Chain D = 1.8e-18 26 34 View alignment 2v7z ( Chain: A, B) Crystal structure of the 70-kda heat shock cognate protein from rattus norvegicus in post-atp hydrolysis state PDB_Info PDB_Structure Rattus norvegicus Chain A = 2.4e-22 25 35 View alignment SCOP MMDB CATH Chain B = 2.4e-22 25 35 View alignment 2qxl ( Chain: A, B) Crystal structure analysis of sse1, a yeast hsp110 PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 3.6e-21 22 33 View alignment SCOP MMDB CATH Chain B = 3.6e-21 22 33 View alignment 3i33 ( Chain: A) Heat shock-related 70 k PDB_Info PDB_Structure Unknown 4.9e-21 26 34 View alignment SCOP MMDB CATH 3fe1 ( Chain: A, C, B) Crystal structure of the human heat shock 70kda protein 6 (hsp70b') atp-ase domain in complex with adp PDB_Info PDB_Structure Homo sapiens Chain A = 5.6e-21 27 35 View alignment SCOP MMDB CATH Chain C = 5.6e-21 27 35 View alignment Chain B = 5.6e-21 27 35 View alignment 1ba0 ( Chain: A) Heat-shock cognate 70kd protein 44kd atpase n-terminal 1nge 3 PDB_Info PDB_Structure Bos taurus 2.2e-20 27 35 View alignment SCOP MMDB CATH 3cqx ( Chain: A, B) Chaperone complex PDB_Info PDB_Structure Mus musculus Chain A = 2.2e-20 25 35 View alignment SCOP MMDB CATH Chain B = 2.2e-20 25 35 View alignment 2qwm ( Chain: B, A) Crystal structure of bovine hsc70 (1-394aa)in the adp*vi state PDB_Info PDB_Structure Bos taurus Chain B = 4.0e-20 27 34 View alignment SCOP MMDB CATH Chain A = 4.0e-20 27 34 View alignment 2qw9 ( Chain: A, B) Crystal structure of bovine hsc70 (1-394aa)in the apo state PDB_Info PDB_Structure Bos taurus Chain A = 4.0e-20 27 34 View alignment SCOP MMDB CATH Chain B = 4.0e-20 27 34 View alignment 2qwl ( Chain: A, B) Crystal structure of bovine hsc70 (1-394aa)in the adp state PDB_Info PDB_Structure Bos taurus Chain A = 4.0e-20 27 34 View alignment SCOP MMDB CATH Chain B = 4.0e-20 27 34 View alignment 3gl1 ( Chain: A, B) Crystal structure of atpase domain of ssb1 chaperone, a member of the hsp70 family, from saccharomyces cerevisiae PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 5.2e-20 26 35 View alignment SCOP MMDB CATH Chain B = 5.2e-20 26 35 View alignment 1ba1 ( Chain: A) Heat-shock cognate 70kd protein 44kd atpase n-terminal mutant with cys 17 replaced by lys PDB_Info PDB_Structure Bos taurus 5.2e-20 25 34 View alignment SCOP MMDB CATH 1ngc ( Chain: A) Structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment PDB_Info PDB_Structure Bos taurus 5.2e-20 27 35 View alignment SCOP MMDB CATH 1ngd ( Chain: A) Structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment PDB_Info PDB_Structure Bos taurus 5.2e-20 27 35 View alignment SCOP MMDB CATH 2qwq ( Chain: A) Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa) d876c in the amppnp hydrolyzed form PDB_Info PDB_Structure Bos taurus 5.4e-20 27 34 View alignment SCOP MMDB CATH 2qwn ( Chain: A) Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)r171c and bovine auxilin (810-910aa) d876c in the adp*pi state PDB_Info PDB_Structure Bos taurus 5.4e-20 27 34 View alignment SCOP MMDB CATH 2qwr ( Chain: A) Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa) d876c in the amppnp intact form PDB_Info PDB_Structure Bos taurus 5.4e-20 27 34 View alignment SCOP MMDB CATH 2qwo ( Chain: A) Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa) d876c in the adp*pi form #1 PDB_Info PDB_Structure Bos taurus 5.4e-20 27 34 View alignment SCOP MMDB CATH 2qwp ( Chain: A) Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa) d876c in the adp*pi form #2 PDB_Info PDB_Structure Bos taurus 5.4e-20 27 34 View alignment SCOP MMDB CATH 2bup ( Chain: A) T13g mutant of the atpase fragment of bovine hsc70 PDB_Info PDB_Structure Bos taurus 5.9e-20 27 34 View alignment SCOP MMDB CATH 3fzm ( Chain: A) Crystal structures of hsc70/bag1 in complex with small molecule inhibitors PDB_Info PDB_Structure Homo sapiens 5.9e-20 27 34 View alignment SCOP MMDB CATH 3fzh ( Chain: A) Crystal structures of hsc70/bag1 in complex with small molecule inhibitors PDB_Info PDB_Structure Homo sapiens 5.9e-20 27 34 View alignment SCOP MMDB CATH 3fzk ( Chain: A) Crystal structures of hsc70/bag1 in complex with small molecule inhibitors PDB_Info PDB_Structure Homo sapiens 5.9e-20 27 34 View alignment SCOP MMDB CATH 3fzf ( Chain: A) Crystal structure of hsc70/bag1 in complex with atp PDB_Info PDB_Structure Homo sapiens 5.9e-20 27 34 View alignment SCOP MMDB CATH 3fzl ( Chain: A) Crystal structures of hsc70/bag1 in complex with small molecule inhibitors PDB_Info PDB_Structure Homo sapiens 5.9e-20 27 34 View alignment SCOP MMDB CATH 1hpm ( Chain: A) How potassium affects the activity of the molecular chaperone hsc70. ii. potassium binds specifically in the atpase active site PDB_Info PDB_Structure Bos taurus 6.1e-20 27 34 View alignment SCOP MMDB CATH 1ngj ( Chain: A) Structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment PDB_Info PDB_Structure Bos taurus 6.1e-20 27 34 View alignment SCOP MMDB CATH 1ngi ( Chain: A) Structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment PDB_Info PDB_Structure Bos taurus 6.1e-20 27 34 View alignment SCOP MMDB CATH 1bup ( Chain: A) T13s mutant of bovine 70 kilodalton heat shock protein PDB_Info PDB_Structure Bos taurus 6.1e-20 27 34 View alignment SCOP MMDB CATH 1ngg ( Chain: A) Structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment PDB_Info PDB_Structure Bos taurus 6.1e-20 27 34 View alignment SCOP MMDB CATH 3hsc ( Chain: A) Three-dimensional structure of the atpase fragment of a 70k heat-shock cognate protein PDB_Info PDB_Structure Bos taurus 6.1e-20 27 34 View alignment SCOP MMDB CATH 1ngh ( Chain: A) Structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment PDB_Info PDB_Structure Bos taurus 6.1e-20 27 34 View alignment SCOP MMDB CATH 1hx1 ( Chain: A) Crystal structure of a bag domain in complex with the hsc70 atpase domain PDB_Info PDB_Structure Bos taurus | Homo sapiens 6.4e-20 27 34 View alignment SCOP MMDB CATH 1ats ( Chain: A) Threonine 204 of the chaperone protein hsc70 influences the structure of the active site but is not essential for atp hydrolysis PDB_Info PDB_Structure Bos taurus 9.3e-20 27 34 View alignment SCOP MMDB CATH 1ngb ( Chain: A) Structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment PDB_Info PDB_Structure Bos taurus 1.0e-19 27 34 View alignment SCOP MMDB CATH 1atr ( Chain: A) Threonine 204 of the chaperone protein hsc70 influences the structure of the active site but is not essential for atp hydrolysis PDB_Info PDB_Structure Bos taurus 1.0e-19 27 34 View alignment SCOP MMDB CATH 1kaz ( Chain: A) Kd heat shock cognate protein atpase domain, k71e mutant PDB_Info PDB_Structure Bos taurus 1.1e-19 27 34 View alignment SCOP MMDB CATH 1ngf ( Chain: A) Structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment PDB_Info PDB_Structure Bos taurus 1.4e-19 27 34 View alignment SCOP MMDB CATH 1kay ( Chain: A) Kd heat shock cognate protein atpase domain, k71a mutant PDB_Info PDB_Structure Bos taurus 1.6e-19 27 34 View alignment SCOP MMDB CATH 1nga ( Chain: A) Structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment PDB_Info PDB_Structure Bos taurus 1.7e-19 27 34 View alignment SCOP MMDB CATH 1qqn ( Chain: A) D206s mutant of bovine 70 kilodalton heat shock protein PDB_Info PDB_Structure Bos taurus 1.9e-19 27 35 View alignment SCOP MMDB CATH 1kax ( Chain: A) Kd heat shock cognate protein atpase domain, k71m mutant PDB_Info PDB_Structure Bos taurus 1.9e-19 27 34 View alignment SCOP MMDB CATH 1nge ( Chain: A) Structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment PDB_Info PDB_Structure Bos taurus 1.9e-19 27 34 View alignment SCOP MMDB CATH 1qqo ( Chain: A) E175s mutant of bovine 70 kilodalton heat shock protein PDB_Info PDB_Structure Bos taurus 3.3e-19 27 34 View alignment SCOP MMDB CATH 1qqm ( Chain: A) D199s mutant of bovine 70 kilodalton heat shock protein PDB_Info PDB_Structure Bos taurus 9.0e-19 26 35 View alignment SCOP MMDB CATH 3gdq ( Chain: A) Atp-ase domain of the human heat shock 70 kda protein 1- like in complex with adp PDB_Info PDB_Structure Homo sapiens 1.3e-18 26 35 View alignment SCOP MMDB CATH 1s3x ( Chain: A) The crystal structure of the human hsp70 atpase domain PDB_Info PDB_Structure Homo sapiens 1.5e-18 26 34 View alignment SCOP MMDB CATH 1hjo ( Chain: A) Heat-shock 70kd protein 42kd atpase n-terminal domain PDB_Info PDB_Structure Homo sapiens 1.8e-18 26 34 View alignment SCOP MMDB CATH 2e8a ( Chain: A) Crystal structure of the human hsp70 atpase domain in complex with amp-pnp PDB_Info PDB_Structure Homo sapiens 2.0e-18 26 34 View alignment SCOP MMDB CATH 2e88 ( Chain: A) Crystal structure of the human hsp70 atpase domain in the apo form PDB_Info PDB_Structure Homo sapiens 2.0e-18 26 34 View alignment SCOP MMDB CATH 2kho ( Chain: A) Heat shock protein 70 PDB_Info PDB_Structure Unknown 2.2e-18 22 35 View alignment SCOP MMDB CATH 3iuc ( Chain: C, A) Heat shock 70kDa protei PDB_Info PDB_Structure Unknown Chain C = 6.4e-18 26 33 View alignment SCOP MMDB CATH Chain A = 6.4e-18 26 33 View alignment 1dkg ( Chain: D) Crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak PDB_Info PDB_Structure Escherichia coli 1.8e-15 24 35 View alignment SCOP MMDB CATH 2v7y ( Chain: A) Crystal structure of the molecular chaperone dnak from geobacillus kaustophilus hta426 in post-atp hydrolysis state PDB_Info PDB_Structure Geobacillus kaustophilus HTA426 7.5e-15 24 32 View alignment SCOP MMDB CATH 1xqs ( Chain: C, D) Crystal structure of the hspbp1 core domain complexed with the fragment of hsp70 atpase domain PDB_Info PDB_Structure Homo sapiens Chain C = 5.1e-11 30 34 View alignment SCOP MMDB CATH Chain D = 5.1e-11 30 34 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
LHS1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YKL073W	SGD Systematic Sequence
853789	NCBI: Gene ID
NP_012850.1	NCBI: RefSeq protein version ID
NP_012850.1	NCBI: RefSeq protein version ID
6322777	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
34 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Copic A, et al. (2009) Genomewide analysis reveals novel pathways affecting endoplasmic reticulum homeostasis, protein modification and quality control. Genetics 182(3):757-69	|ALG3 |CSF1 |EOS1 |HAC1 |HTZ1 |KAR2 |MNN11 |MRPL16 |PHO88 |UBX2 |YLR065C
Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Gong Y, et al. (2009) An atlas of chaperone-protein interactions in Saccharomyces cerevisiae: implications to protein folding pathways in the cell. Mol Syst Biol 5:275	|APJ1 |CAJ1 |CWC23 |DJP1 |ECM10 |ERJ5 |GIM3 |GIM4 |GIM5 |HLJ1 |HSC82 |HSP104 |HSP12 |HSP26 |MORE
Large-scale phenotype analysis	Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508	|AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |MORE
Fungal Related Genes/Proteins	Yi M, et al. (2009) The ER Chaperone LHS1 Is Involved in Asexual Development and Rice Infection by the Blast Fungus Magnaporthe oryzae. Plant Cell 21(2):681-95	|KAR2
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Physical Properties Protein-protein Interactions Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents	de Keyzer J, et al. (2009) Nucleotide binding by Lhs1p is essential for its nucleotide exchange activity and for function in vivo. J Biol Chem 284(46):31564-71	|IRE1 |KAR2
Genetic Interactions Mutants/Phenotypes RNA Levels and Processing Regulation of Strains/Constructs	Payne T, et al. (2008) Modulation of Chaperone Gene Expression in Mutagenized Saccharomyces cerevisiae Strains Developed for Recombinant Human Albumin Production Results in Increased Production of Multiple Heterologous Proteins. Appl Environ Microbiol 74(24):7759-66	|HAC1 |JEM1 |SCJ1 |SIL1
Regulation of	Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439	|ADD37 |AFR1 |AGX1 |AHA1 |AIM17 |ALD4 |ALG13 |ARA1 |ASI1 |ATG12 |ATG8 |BAG7 |BDH1 |CAD1 |MORE
Evolution Fungal Related Genes/Proteins	Coronado JE, et al. (2007) Conserved processes and lineage-specific proteins in fungal cell wall evolution. Eukaryot Cell 6(12):2269-77	|ACF2 |AGA1 |AGA2 |ANS1 |BAR1 |BGL2 |BSC1 |CCW12 |CCW14 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |MORE
Fungal Related Genes/Proteins	Georg Rde C and Gomes SL (2007) Comparative expression analysis of members of the Hsp70 family in the chytridiomycete Blastocladiella emersonii. Gene 386(1-2):24-34	|ECM10 |KAR2 |SSA1 |SSA2 |SSA3 |SSA4 |SSB1 |SSB2 |SSC1 |SSE1 |SSE2 |SSZ1
RNA Levels and Processing	Cullen PJ, et al. (2006) Genome-wide analysis of the response to protein glycosylation deficiency in yeast. FEMS Yeast Res 6(8):1264-73	|ACS1 |ADR1 |ALD6 |AMS1 |CHS1 |CHS3 |CHS7 |CLB1 |CLB2 |CLN1 |CLN2 |CLN3 |CTT1 |DER1 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Genetic Interactions	Takeuchi M, et al. (2006) Saccharomyces cerevisiae Rot1p is an ER-localized membrane protein that may function with BiP/Kar2p in protein folding. J Biochem 139(3):597-605	|CNE1 |KAR2 |ROT1 |SCJ1
Regulation of Transcription	Seppa L and Makarow M (2005) Regulation and recovery of functions of Saccharomyces cerevisiae chaperone BiP/Kar2p after thermal insult. Eukaryot Cell 4(12):2008-16	|HSP78 |KAR2
Non-Fungal Related Genes/Proteins	Nikolaidis N and Nei M (2004) Concerted and nonconcerted evolution of the Hsp70 gene superfamily in two sibling species of nematodes. Mol Biol Evol 21(3):498-505	|KAR2 |SSA1 |SSA2 |SSA3 |SSA4 |SSC1 |SSE1 |SSE2 |SSQ1 |SSZ1
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Regulation of Regulatory Role Strains/Constructs Techniques and Reagents	Steel GJ, et al. (2004) Coordinated activation of Hsp70 chaperones. Science 303(5654):98-101	|IRE1 |KAR2 |SEC63 |SIL1
Function/Process Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Yabal M, et al. (2003) Translocation of the C terminus of a tail-anchored protein across the endoplasmic reticulum membrane in yeast mutants defective in signal peptide-driven translocation. J Biol Chem 278(5):3489-96	|KAR2 |SBH1 |SBH2 |SEC61 |SEC62 |SEC63
RNA Levels and Processing Regulation of	Alexandre H, et al. (2001) Global gene expression during short-term ethanol stress in Saccharomyces cerevisiae. FEBS Lett 498(1):98-103	|AHP1 |ALD2 |ALD4 |APJ1 |ATG8 |CCC2 |CDC19 |CIT1 |CIT2 |CPR6 |CTT1 |DAK1 |EMI2 |ERO1 |MORE
RNA Levels and Processing Regulation of	Casagrande R, et al. (2000) Degradation of proteins from the ER of S. cerevisiae requires an intact unfolded protein response pathway. Mol Cell 5(4):729-35	|ERO1 |HAC1 |IRE1 |KAR2 |PDI1
Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Chang WH and Kornberg RD (2000) Electron crystal structure of the transcription factor and DNA repair complex, core TFIIH. Cell 102(5):609-13	|KIN28 |RAD3 |RAD4 |SSL1 |TFB1 |TFB2 |TFB3
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Ng DT, et al. (2000) The unfolded protein response regulates multiple aspects of secretory and membrane protein biogenesis and endoplasmic reticulum quality control. J Cell Biol 150(1):77-88	|GAS1 |GPI10 |HAC1 |IRE1 |KAR2 |MCD4 |PER1 |PRC1 |RFT1 |RPN4 |SEC61 |UBC7
Regulation of	Travers KJ, et al. (2000) Functional and genomic analyses reveal an essential coordination between the unfolded protein response and ER-associated degradation. Cell 101(3):249-58	|ERO1 |EUG1 |FPR2 |INO1 |IRE1 |KAR2 |OPI1 |PDI1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes	Tyson JR and Stirling CJ (2000) LHS1 and SIL1 provide a lumenal function that is essential for protein translocation into the endoplasmic reticulum. EMBO J 19(23):6440-52	|IRE1 |KAR2 |SIL1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs Substrates/Ligands/Cofactors	Hamilton TG, et al. (1999) Cer1p functions as a molecular chaperone in the endoplasmic reticulum of Saccharomyces cerevisiae. Mol Cell Biol 19(8):5298-307	|KAR2
Fungal Related Genes/Proteins	Hanninen AL, et al. (1999) The cytoplasmic chaperone hsp104 is required for conformational repair of heat-denatured proteins in the yeast endoplasmic reticulum. Mol Biol Cell 10(11):3623-32	|HSP104 |HSP150
RNA Levels and Processing Regulation of	Jelinsky SA and Samson LD (1999) Global response of Saccharomyces cerevisiae to an alkylating agent. Proc Natl Acad Sci U S A 96(4):1486-91	|AAD14 |AAD16 |AAD4 |AAD6 |ABF1 |ADP1 |AGX1 |AMD2 |ARG1 |ARG3 |ARG4 |ARG5,6 |ARG7 |ARO1 |MORE
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Chervitz SA, et al. (1998) Comparison of the complete protein sets of worm and yeast: orthology and divergence. Science 282(5396):2022-8	|ACT1 |ARP1 |ARP2 |ARP3 |ARP4 |ARP5 |ARP6 |ARP7 |CDC28 |CTF18 |ECM10 |KAR2 |PRE1 |PRE10 |MORE
Reviews	Morano KA, et al. (1998) Protein chaperones and the heat shock response in Saccharomyces cerevisiae. Curr Opin Microbiol 1(2):197-203	|CPR7
DNA/RNA Sequence Features	Mori K, et al. (1998) Palindrome with spacer of one nucleotide is characteristic of the cis-acting unfolded protein response element in Saccharomyces cerevisiae. J Biol Chem 273(16):9912-20	|EUG1 |FPR2 |HAC1 |KAR2 |PDI1 |SCJ1
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Saris N and Makarow M (1998) Transient ER retention as stress response: conformational repair of heat-damaged proteins to secretion-competent structures. J Cell Sci 111 ( Pt 11):1575-82
Function/Process Mutants/Phenotypes Protein Processing/Modification/Regulation Regulatory Role Strains/Constructs	Saris N, et al. (1997) The Hsp70 homologue Lhs1p is involved in a novel function of the yeast endoplasmic reticulum, refolding and stabilization of heat-denatured protein aggregates. J Cell Biol 137(4):813-24	|HSP150
Alias Cellular Location DNA/RNA Sequence Features Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features RNA Levels and Processing Regulation of Strains/Constructs Techniques and Reagents Transcription	Baxter BK, et al. (1996) SSI1 encodes a novel Hsp70 of the Saccharomyces cerevisiae endoplasmic reticulum. Mol Cell Biol 16(11):6444-56	|KAR2
Alias Cellular Location DNA/RNA Sequence Features Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Physical Properties Protein Sequence Features RNA Levels and Processing Regulation of Transcription	Craven RA, et al. (1996) A novel Hsp70 of the yeast ER lumen is required for the efficient translocation of a number of protein precursors. EMBO J 15(11):2640-50	|IRE1 |KAR2 |SEC11 |SEC53 |SEC59
Cellular Location Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Hamilton TG and Flynn GC (1996) Cer1p, a novel Hsp70-related protein required for posttranslational endoplasmic reticulum translocation in yeast. J Biol Chem 271(48):30610-3	|KAR2 |SCJ1
DNA/RNA Sequence Features	Rasmussen SW (1994) Sequence of a 20.7 kb region of yeast chromosome XI includes the NUP100 gene, an open reading frame (ORF) possibly representing a nucleoside diphosphate kinase gene, tRNAs for His, Val and Trp in addition to seven ORFs with weak or no significant similarity to known proteins. Yeast 10 Suppl A:S69-74	|NUP100 |YKL066W |YKL070W

Return to SGD

Send a Message to the SGD Curators