---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP100/YKL068W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXI: 309843 to 312722 CDS: 309843 - 312722 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP100	YKL068W	NSP100	ORF, Verified	S000001551
Description
Subunit of the nuclear pore complex (NPC) that is localized to both sides of the pore; contains a repetitive GLFG motif that interacts with mRNA export factor Mex67p and with karyopherin Kap95p; homologous to Nup116p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007230 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007230 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP100/YKL068W for NUP100 NUP100 encodes a nuclear pore protein (1, 2). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 2, 3, 4, 5). The structure of the vertebrate NPC has been studied extensively; recent reviews include 6, 7, 8, and 9. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (10, 11). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 2, 3, 12, 13, 14). NUP100 is not essential, but the nup100 deletion is synthetically lethal with mutations in genes encoding other nucleoporins and other nucleocytoplasmic transport factors (2, 15). Nup100p is one of a group of nucleoporins that contain multiple repeats of the amino acids GLFG (1, 2). Nup100p and Nup116p are similar over their entire lengths, and may have arisen by gene duplication (1, 16, 2). A related nucleoporin, Nup98, has been identified in vertebrates (2). Nup100p may have a role in recycling transport factors from the nucleus to the cytoplasm, as it interacts physically with Kap95p. The interaction involves the GLFG repeats of Nup100p and the nuclear export signal (NES) of Kap95p (17). Last Updated: 1999-08-06

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP100/YKL068W for NUP100 1) Wente SR, et al. (1992) A new family of yeast nuclear pore complex proteins. J Cell Biol 119(4):705-23      2) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      3) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    4) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      5) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      6) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      7) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      8) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      9) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      10) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      11) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        12) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      13) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        14) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      15) Ho AK, et al. (1998) The integral membrane protein snl1p is genetically linked to yeast nuclear pore complex function. Mol Biol Cell 9(2):355-73        16) Wente SR and Blobel G (1994) NUP145 encodes a novel yeast glycine-leucine-phenylalanine-glycine (GLFG) nucleoporin required for nuclear envelope structure. J Cell Biol 125(5):955-69      17) Iovine MK and Wente SR (1997) A nuclear export signal in Kap95p is required for both recycling the import factor and interaction with the nucleoporin GLFG repeat regions of Nup116p and Nup100p. J Cell Biol 137(4):797-811        18) Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51        19) Strawn LA, et al. (2001) The GLFG regions of Nup116p and Nup100p serve as binding sites for both Kap95p and Mex67p at the nuclear pore complex. J Biol Chem 276(9):6445-52

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP100/YKL068W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP100/YKL068W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MFGNNRP C-term IDHPVLT Length(aa) 959 MW(Da) 99,988 pI 10.15 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.009   Codon Adaptation Index 0.107   Frequency of Optimal Codons 0.392   Hydropathicity of Protein -0.704   Aromaticity Score 0.076

10 20 30 40 50 | | | | | MFGNNRPMFGGSNLSFGSNTSSFGGQQSQQPNSLFGNSNNNNNSTSNNAQ SGFGGFTSAAGSNSNSLFGNNNTQNNGAFGQSMGATQNSPFGSLNSSNAS NGNTFGGSSSMGSFGGNTNNAFNNNSNSTNSPFGFNKPNTGGTLFGSQNN NSAGTSSLFGGQSTSTTGTFGNTGSSFGTGLNGNGSNIFGAGNNSQSNTT GSLFGNQQSSAFGTNNQQGSLFGQQSQNTNNAFGNQNQLGGSSFGSKPVG SGSLFGQSNNTLGNTTNNRNGLFGQMNSSNQGSSNSGLFGQNSMNSSTQG VFGQNNNQMQINGNNNNSLFGKANTFSNSASGGLFGQNNQQQGSGLFGQN SQTSGSSGLFGQNNQKQPNTFTQSNTGIGLFGQNNNQQQQSTGLFGAKPA GTTGSLFGGNSSTQPNSLFGTTNVPTSNTQSQQGNSLFGATKLTNMPFGG NPTANQSGSGNSLFGTKPASTTGSLFGNNTASTTVPSTNGLFGNNANNST STTNTGLFGAKPDSQSKPALGGGLFGNSNSNSSTIGQNKPVFGGTTQNTG LFGATGTNSSAVGSTGKLFGQNNNTLNVGTQNVPPVNNTTQNALLGTTAV PSLQQAPVTNEQLFSKISIPNSITNPVKATTSKVNADMKRNSSLTSAYRL APKPLFAPSSNGDAKFQKWGKTLERSDRGSSTSNSITDPESSYLNSNDLL FDPDRRYLKHLVIKNNKNLNVINHNDDEASKVKLVTFTTESASKDDQASS SIAASKLTEKAHSPQTDLKDDHDESTPDPQSKSPNGSTSIPMIENEKISS KVPGLLSNDVTFFKNNYYISPSIETLGNKSLIELRKINNLVIGHRNYGKV EFLEPVDLLNTPLDTLCGDLVTFGPKSCSIYENCSIKPEKGEGINVRCRV TLYSCFPIDKETRKPIKNITHPLLKRSIAKLKENPVYKFESYDPVTGTYS YTIDHPVLT*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP100/YKL068W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to NUP100 Homolog Source (per PDB) Protein Alignment: NUP100 vs. Homolog External Links P-Value %Identical %Similar Alignment 2aiv ( Chain: A) Multiple conformations in the ligand-binding site of the yeast nuclear pore targeting domain of nup116p PDB_Info PDB_Structure Saccharomyces cerevisiae 3.0e-24 57 24 View alignment SCOP MMDB CATH 1ko6 ( Chain: C, A) Crystal structure of c-terminal autoproteolytic domain of nucleoporin nup98 PDB_Info PDB_Structure Homo sapiens Chain C = 0.001100 28 27 View alignment SCOP MMDB CATH Chain A = 0.001100 28 27 View alignment 2q5y ( Chain: A, C) Crystal structure of the c-terminal domain of hnup98 PDB_Info PDB_Structure Homo sapiens Chain A = 0.001400 29 29 View alignment SCOP MMDB CATH Chain C = 0.001400 29 29 View alignment 2q5x ( Chain: A) Crystal structure of the c-terminal domain of hnup98 PDB_Info PDB_Structure Homo sapiens 0.001500 29 29 View alignment SCOP MMDB CATH 4cgt ( Chain: A) Deletion mutant delta(145-150), f151d of cyclodextrin glycosyltransferase PDB_Info PDB_Structure Bacillus circulans 0.003101 20 35 View alignment SCOP MMDB CATH 1cgu ( Chain: A) Catalytic center of cyclodextrin glycosyltransferase derived from x-ray structure analysis combined with site- directed mutagenesis PDB_Info PDB_Structure Bacillus circulans 0.005799 20 36 View alignment SCOP MMDB CATH 7cgt ( Chain: A) Rameb complex of cyclodextrin glycosyltransferase mutant PDB_Info PDB_Structure Bacillus circulans 0.005799 20 36 View alignment SCOP MMDB CATH 6cgt ( Chain: A) Hoxa complex of cyclodextrin glycosyltransferase mutant PDB_Info PDB_Structure Bacillus circulans 0.005799 20 36 View alignment SCOP MMDB CATH 1cgt ( Chain: A) Structure of cyclodextrin glycosyltransferase refined at 2.0 angstroms resolution PDB_Info PDB_Structure Bacillus circulans 0.005799 20 36 View alignment SCOP MMDB CATH 5cgt ( Chain: A) Maltotriose complex of preconditioned cyclodextrin glycosyltransferase mutant PDB_Info PDB_Structure Bacillus circulans 0.005799 20 36 View alignment SCOP MMDB CATH 8cgt ( Chain: A) Structure of cyclodextrin glycosyltransferase complexed with a thio-maltohexaose PDB_Info PDB_Structure Bacillus circulans 0.008304 21 35 View alignment SCOP MMDB CATH 3cgt ( Chain: A) Structure of cyclodextrin glycosyltransferase complexed with its main product beta-cyclodextrin PDB_Info PDB_Structure Bacillus circulans 0.008304 21 35 View alignment SCOP MMDB CATH 9cgt ( Chain: A) Structure of cyclodextrin glycosyltransferase complexed with a thio-maltopentaose PDB_Info PDB_Structure Bacillus circulans 0.008304 21 35 View alignment SCOP MMDB CATH 1ru4 ( Chain: A) Crystal structure of pectate lyase pel9a PDB_Info PDB_Structure Erwinia chrysanthemi 0.009195 21 36 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP100	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YKL068W	SGD Systematic Sequence
853796	NCBI: Gene ID
NP_012855.1	NCBI: RefSeq protein version ID
NP_012855.1	NCBI: RefSeq protein version ID
6322782	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
57 curated references; 0 references not yet curated
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP1 |NUP116 |NUP133 |NUP145 |NUP159 |NUP188 |MORE
Protein-protein Interactions Strains/Constructs	Alberti S, et al. (2009) A systematic survey identifies prions and illuminates sequence features of prionogenic proteins. Cell 137(1):146-58	|AIM3 |AKL1 |ASM4 |AZF1 |CAF40 |CBK1 |CCR4 |CLA4 |CYC8 |DDR48 |DEF1 |ENT1 |ENT2 |EPL1 |MORE
Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Beliakova-Bethell N, et al. (2009) Ty3 nuclear entry is initiated by viruslike particle docking on GLFG nucleoporins. J Virol 83(22):11914-25	|NSP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP159 |NUP42 |NUP49 |NUP57 |YGR109W-A |YGR109W-B |YIL080W |YIL082W |YIL082W-A
RNA Levels and Processing	Chen AK, et al. (2009) Response of Saccharomyces cerevisiae to stress-free acidification. J Microbiol 47(1):1-8	|ACE2 |ACO1 |ARN1 |ARN2 |ARP4 |ATP1 |ATP16 |ATP2 |ATP3 |BRF1 |CAP1 |CAP2 |CBF5 |CCC2 |MORE
Cellular Location Regulation of	Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73	|APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP133 |NUP157 |NUP159 |NUP170 |MORE
Protein-protein Interactions	Hung NJ, et al. (2008) Arx1 Is a Nuclear Export Receptor for the 60S Ribosomal Subunit in Yeast. Mol Biol Cell 19(2):735-44	|ARX1 |CRM1 |GLE2 |MEX67 |MTR2 |NIC96 |NMD3 |NSP1 |NUP116 |NUP120 |NUP133 |NUP42 |NUP57 |NUP82 |MORE
Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Patel SS and Rexach MF (2008) Discovering novel interactions at the nuclear pore complex using bead halo: a rapid method for detecting molecular interactions of high and low affinity at equilibrium. Mol Cell Proteomics 7(1):121-31	|ASM4 |GLE1 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP116 |NUP53 |NUP60 |NUP84 |POM34 |SEH1 |SRM1 |MORE
Mutants/Phenotypes	Thomsen R, et al. (2008) General, rapid, and transcription-dependent fragmentation of nucleolar antigens in S. cerevisiae mRNA export mutants. RNA 14(4):706-16	|ASM4 |HPR1 |HSP104 |MEX67 |MFT1 |NOP1 |NOP58 |NSR1 |NUP120 |NUP133 |NUP159 |NUP188 |NUP2 |NUP42 |MORE
Genetic Interactions Strains/Constructs	Wilmes GM, et al. (2008) A genetic interaction map of RNA-processing factors reveals links between Sem1/Dss1-containing complexes and mRNA export and splicing. Mol Cell 32(5):735-46	|APQ12 |BRR1 |CAK1 |CBC2 |CHD1 |CSN12 |CSN9 |DBP5 |GIM4 |IST3 |ISY1 |LRP1 |MEX67 |MUD2 |MORE
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Evolution Protein Sequence Features Protein/Nucleic Acid Structure	Denning DP and Rexach MF (2007) Rapid evolution exposes the boundaries of domain structure and function in natively unfolded FG nucleoporins. Mol Cell Proteomics 6(2):272-82	|ASM4 |NSP1 |NUP1 |NUP116 |NUP159 |NUP2 |NUP42 |NUP49 |NUP53 |NUP57 |NUP60
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Protein-protein Interactions Strains/Constructs	Olsson I, et al. (2007) The arginine methyltransferase Rmt2 is enriched in the nucleus and co-purifies with the nuclear porins Nup49, Nup57 and Nup100. Exp Cell Res 313(9):1778-89	|MYO1 |NUP49 |NUP57 |RMT2 |YOL013W-A
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP116 |NUP120 |NUP157 |NUP159 |NUP170 |NUP192 |NUP2 |MORE
Non-Fungal Related Genes/Proteins Protein Physical Properties Protein-protein Interactions	Ratner GA, et al. (2007) Molecular Determinants of Binding between Gly-Leu-Phe-Gly Nucleoporins and the Nuclear Pore Complex. J Biol Chem 282(47):33968-76	|NUP116 |NUP145
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Terry LJ and Wente SR (2007) Nuclear mRNA export requires specific FG nucleoporins for translocation through the nuclear pore complex. J Cell Biol 178(7):1121-32	|KAP104 |MEX67 |NSP1 |NUP1 |NUP116 |NUP145 |NUP2 |NUP49 |NUP57 |NUP60 |PSE1
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |MORE
Cellular Location	Miao M, et al. (2006) The integral membrane protein pom34p functionally links nucleoporin subcomplexes. Genetics 172(3):1441-57	|ASM4 |GLE2 |NSP1 |NUP116 |NUP120 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP57 |NUP82 |POM152 |POM34 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Preker PJ and Guthrie C (2006) Autoregulation of the mRNA export factor Yra1p requires inefficient splicing of its pre-mRNA. RNA 12(6):994-1006	|CCR4 |EDC2 |HPR1 |KEM1 |MFT1 |MLP1 |MLP2 |NAM7 |NUP84 |PAN2 |RFT1 |RRP6 |SKI2 |SPT4 |MORE
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Function/Process Protein Physical Properties Protein Sequence Features Protein-protein Interactions	Titz B, et al. (2006) Transcriptional activators in yeast. Nucleic Acids Res 34(3):955-67	|ACA1 |ACE2 |ACF2 |ADR1 |AHC2 |AIR1 |AOS1 |APC4 |APL2 |ASM4 |ATC1 |BCK2 |BFR2 |BSC5 |MORE
Protein Processing/Modification/Regulation	Mason DA, et al. (2005) Increased nuclear envelope permeability and Pep4p-dependent degradation of nucleoporins during hydrogen peroxide-induced cell death. FEMS Yeast Res 5(12):1237-51	|MCA1 |NSP1 |NUP1 |NUP116 |NUP159 |NUP53 |NUP84 |NUP85 |PAI3 |PEP4 |POM152 |PRB1 |SEH1
Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Nazarenus T, et al. (2005) Upf1p, a highly conserved protein required for nonsense-mediated mRNA decay, interacts with the nuclear pore proteins Nup100p and Nup116p. Gene 345(2):199-212	|GSY1 |NAM7 |NUP116
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features	Robinson MA, et al. (2005) Multiple conformations in the ligand-binding site of the yeast nuclear pore-targeting domain of Nup116p. J Biol Chem 280(42):35723-32	|NUP116 |NUP145
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Protein-protein Interactions	Pyhtila B and Rexach M (2003) A gradient of affinity for the karyopherin Kap95p along the yeast nuclear pore complex. J Biol Chem 278(43):42699-709	|GSP1 |KAP95 |NUP1 |NUP42 |SRP1
Cell Cycle Phase Involved Mutants/Phenotypes	Zettel MF, et al. (2003) The budding index of Saccharomyces cerevisiae deletion strains identifies genes important for cell cycle progression. FEMS Microbiol Lett 223(2):253-8	|ACM1 |AFR1 |ALG5 |ARX1 |ATP15 |BEM1 |BEM4 |BUB1 |BUR2 |CLB2 |CTF4 |CTF8 |CWP1 |DCC1 |MORE
Protein-protein Interactions	Allen NP, et al. (2002) Deciphering networks of protein interactions at the nuclear pore complex. Mol Cell Proteomics 1(12):930-46	|CRM1 |CSE1 |GSP1 |KAP95 |MEX67 |NUP116 |NUP120 |NUP133 |NUP159 |NUP2 |NUP49 |NUP84 |NUP85 |PAB1 |MORE
Mutants/Phenotypes Strains/Constructs	Iouk T, et al. (2002) The yeast nuclear pore complex functionally interacts with components of the spindle assembly checkpoint. J Cell Biol 159(5):807-19	|ASM4 |MAD1 |MAD2 |NUP157 |NUP170 |NUP188 |NUP53 |POM152
Function/Process Protein-protein Interactions Techniques and Reagents	Allen NP, et al. (2001) Proteomic analysis of nucleoporin interacting proteins. J Biol Chem 276(31):29268-74	|GSP1 |KAP95 |NUP1 |NUP116 |NUP2 |NUP42 |NUP49 |NUP57 |NUP60 |NUP84 |SRP1
Function/Process Protein Sequence Features Techniques and Reagents	Strawn LA, et al. (2001) The GLFG regions of Nup116p and Nup100p serve as binding sites for both Kap95p and Mex67p at the nuclear pore complex. J Biol Chem 276(9):6445-52	|DBP5 |GLE1 |GLE2 |KAP95 |MEX67 |MTR2 |NUP116
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP116 |NUP120 |NUP133 |NUP145 |MORE
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	York JD, et al. (1999) A phospholipase C-dependent inositol polyphosphate kinase pathway required for efficient messenger RNA export. Science 285(5424):96-100	|GLE1 |IPK1 |PLC1
Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Bailer SM, et al. (1998) Nup116p and nup100p are interchangeable through a conserved motif which constitutes a docking site for the mRNA transport factor gle2p. EMBO J 17(4):1107-19	|GLE2 |NUP116
Genetic Interactions	Ho AK, et al. (1998) The integral membrane protein snl1p is genetically linked to yeast nuclear pore complex function. Mol Biol Cell 9(2):355-73	|GLE2 |NIC96 |NUP116 |POM152 |SNL1
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Function/Process Genetic Interactions Protein-protein Interactions Strains/Constructs Techniques and Reagents	Iovine MK and Wente SR (1997) A nuclear export signal in Kap95p is required for both recycling the import factor and interaction with the nucleoporin GLFG repeat regions of Nup116p and Nup100p. J Cell Biol 137(4):797-811	|GLE2 |GSP1 |KAP95 |NUP1 |NUP116 |SRP1
Fungal Related Genes/Proteins	Teixeira MT, et al. (1997) Two functionally distinct domains generated by in vivo cleavage of Nup145p: a novel biogenesis pathway for nucleoporins. EMBO J 16(16):5086-97	|NUP116 |NUP120 |NUP145 |NUP84 |NUP85 |SEC13 |SEH1
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP116 |NUP120 |NUP133 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |NUP49 |MORE
Protein-protein Interactions	Murphy R and Wente SR (1996) An RNA-export mediator with an essential nuclear export signal. Nature 383(6598):357-60	|GLE1 |NUP42
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Murphy R, et al. (1996) GLE2, a Saccharomyces cerevisiae homologue of the Schizosaccharomyces pombe export factor RAE1, is required for nuclear pore complex structure and function. Mol Biol Cell 7(12):1921-37	|GLE2 |NUP145 |NUP42 |SRP1
Reviews	Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99	|ASM4 |NSP1 |NUP1 |NUP116 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Mutants/Phenotypes Strains/Constructs	Sharma K, et al. (1996) Yeast nucleoporin mutants are defective in pre-tRNA splicing. Mol Cell Biol 16(1):294-301	|NSP1 |NUP1 |NUP116 |NUP133 |NUP145 |NUP49 |NUP85
Protein-protein Interactions	Stutz F, et al. (1996) A role for nucleoporin FG repeat domains in export of human immunodeficiency virus type 1 Rev protein and RNA from the nucleus. Mol Cell Biol 16(12):7144-50	|NUP116 |NUP145 |NUP159 |NUP42 |NUP49 |NUP57
Reviews	Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96	|ASM4 |NSP1 |NUP1 |NUP116 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Reviews	Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41	|NIC96 |NUP116 |NUP133 |NUP159 |NUP188 |NUP2 |NUP57 |NUP82 |NUP84 |NUP85 |POM152
Cellular Location Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Iovine MK, et al. (1995) The GLFG repetitive region of the nucleoporin Nup116p interacts with Kap95p, an essential yeast nuclear import factor. J Cell Biol 131(6 Pt 2):1699-713	|KAP95 |NUP116 |NUP145 |NUP49 |NUP57
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Fabre E, et al. (1994) Nup145p is required for nuclear export of mRNA and binds homopolymeric RNA in vitro via a novel conserved motif. Cell 78(2):275-89	|NSP1 |NUP116 |NUP145
Alias	Rasmussen SW (1994) Sequence of a 20.7 kb region of yeast chromosome XI includes the NUP100 gene, an open reading frame (ORF) possibly representing a nucleoside diphosphate kinase gene, tRNAs for His, Val and Trp in addition to seven ORFs with weak or no significant similarity to known proteins. Yeast 10 Suppl A:S69-74	|LHS1 |YKL066W |YKL070W
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Wente SR and Blobel G (1994) NUP145 encodes a novel yeast glycine-leucine-phenylalanine-glycine (GLFG) nucleoporin required for nuclear envelope structure. J Cell Biol 125(5):955-69	|NUP116 |NUP145 |NUP63
Cellular Location Fungal Related Genes/Proteins Mutants/Phenotypes Other Features Protein Sequence Features Strains/Constructs Techniques and Reagents	Wente SR, et al. (1992) A new family of yeast nuclear pore complex proteins. J Cell Biol 119(4):705-23	|NUP116 |NUP49

Return to SGD

Send a Message to the SGD Curators