---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP120/YKL057C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXI: 333613 to 330500 CDS: 333613 - 330500 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP120	YKL057C	RAT2	ORF, Verified	S000001540
Description
Subunit of the Nup84p subcomplex of the nuclear pore complex (NPC), required for even distribution of NPCs around the nuclear envelope, involved in establishment of a normal nucleocytoplasmic concentration gradient of the GTPase Gsp1p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD chromosome localization Therizols P, et al. (2006) Telomere tethering at the nuclear periphery is essential for efficient DNA double strand break repair in subtelomeric region. J Cell Biol 172(2):189-99          IMP : Inferred from Mutant Phenotype Assigned on 2006-02-22 SGD mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Nup107-160 complex Lutzmann M, et al. (2002) Modular self-assembly of a Y-shaped multiprotein complex from seven nucleoporins. EMBO J 21(3):387-97                IDA : Inferred from Direct Assay Assigned on 2009-10-09 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP120/YKL057C for NUP120 NUP120 encodes a non-essential nuclear pore protein (1, 2). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 3, 4, 5, 6). The structure of the vertebrate NPC has been studied extensively; recent reviews include 7, 8, 9, and 10. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (11, 12). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 3, 4, 13, 14, 15). Nup120p is part of subcomplex within the NPC that also includes Sec13p, Seh1p, Nup84p, and Nup85p (16, 3). PH, A nup120 mutation is synthetically lethal with mutations in NUP133 and NUP159, which also encode nuclear pore proteins. Also, Nup85p cannot be detected in nup120 mutants (17). Last Updated: 1999-08-09

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP120/YKL057C for NUP120 1) Aitchison JD, et al. (1995) Nup120p: a yeast nucleoporin required for NPC distribution and mRNA transport. J Cell Biol 131(6 Pt 2):1659-75      2) Heath CV, et al. (1995) Nuclear pore complex clustering and nuclear accumulation of poly(A)+ RNA associated with mutation of the Saccharomyces cerevisiae RAT2/NUP120 gene. J Cell Biol 131(6 Pt 2):1677-97      3) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      4) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    5) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      6) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      7) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      8) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      9) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      10) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      11) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      12) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        13) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      14) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        15) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      16) Siniossoglou S, et al. (1996) A novel complex of nucleoporins, which includes Sec13p and a Sec13p homolog, is essential for normal nuclear pores. Cell 84(2):265-75        17) Goldstein AL, et al. (1996) Pleiotropic nuclear defects associated with a conditional allele of the novel nucleoporin Rat9p/Nup85p. Mol Biol Cell 7(6):917-34      18) Siniossoglou S, et al. (2000) Structure and assembly of the Nup84p complex. J Cell Biol 149(1):41-54        19) Gao H, et al. (2003) Nuclear accumulation of the small GTPase Gsp1p depends on nucleoporins Nup133p, Rat2p/Nup120p, Nup85p, Nic96p, and the acetyl-CoA carboxylase Acc1p. J Biol Chem 278(28):25331-40

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP120/YKL057C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP120/YKL057C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MACLSRI C-term RDELRGL Length(aa) 1,037 MW(Da) 120,447 pI 4.91 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.059   Codon Adaptation Index 0.157   Frequency of Optimal Codons 0.447   Hydropathicity of Protein -0.118   Aromaticity Score 0.128

10 20 30 40 50 | | | | | MACLSRIDANLLQYYEKPEPNNTVDLYVSNNSNNNGLKEGDKSISTPVPQ PYGSEYSNCLLLSNSEYICYHFSSRSTLLTFYPLSDAYHGKTINIHLPNA SMNQRYTLTIQEVEQQLLVNVILKDGSFLTLQLPLSFLFSSANTLNGEWF HLQNPYDFTVRVPHFLFYVSPQFSVVFLEDGGLLGLKKVDGVHYEPLLFN DNSYLKSLTRFFSRSSKSDYDSVISCKLFHERYLIVLTQNCHLKIWDLTS FTLIQDYDMVSQSDSDPSHFRKVEAVGEYLSLYNNTLVTLLPLENGLFQM GTLLVDSSGILTYTFQNNIPTNLSASAIWSIVDLVLTRPLELNVEASYLN LIVLWKSGTASKLQILNVNDESFKNYEWIESVNKSLVDLQSEHDLDIVTK TGDVERGFCNLKSRYGTQIFERAQQILSENKIIMAHNEDEEYLANLETIL RDVKTAFNEASSITLYGDEIILVNCFQPYNHSLYKLNTTVENWFYNMHSE TDGSELFKYLRTLNGFASTLSNDVLRSISKKFLDIITGELPDSMTTVEKF TDIFKNCLENQFEITNLKILFDELNSFDIPVVLNDLINNQMKPGIFWKKD FISAIKFDGFTSIISLESLHQLLSIHYRITLQVLLTFVLFDLDTEIFGQH ISTLLDLHYKQFLLLNLYRQDKCLLAEVLLKDSSEFSFGVKFFNYGQLIA YIDSLNSNVYNASITENSFFMTFFRSYIIENTSHKNIRFFLENVECPFYL RHNEVQEFMFAMTLFSCGNFDQSYEIFQLHDYPEAINDKLPTFLEDLKSE NYHGDSIWKDLLCTFTVPYRHSAFYYQLSLLFDRNNSQEFALKCISKSAE YSLKEIQIEELQDFKEKQHIHYLNLLIHFRMFEEVLDVLRLGHECLSDTV RTNFLQLLLQEDIYSRDFFSTLLRLCNAHSDNGELYLRTVDIKIVDSILS QNLRSGDWECFKKLYCFRMLNKSERAAAEVLYQYILMQADLDVIRKRKCY LMVINVLSSFDSAYDQWILNGSKVVTLTDLRDELRGL*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP120/YKL057C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to NUP120 Homolog Source (per PDB) Protein Alignment: NUP120 vs. Homolog External Links P-Value %Identical %Similar Alignment 3hxr ( Chain: A) Nucleoporin NUP120 PDB_Info PDB_Structure Unknown 9.9e-262 100 0 View alignment SCOP MMDB CATH 3h7n ( Chain: C, A, B, D) Nucleoporin NUP120 PDB_Info PDB_Structure Unknown Chain C = 9.9e-262 100 0 View alignment SCOP MMDB CATH Chain A = 9.9e-262 100 0 View alignment Chain B = 9.9e-262 100 0 View alignment Chain D = 9.9e-262 100 0 View alignment 3f7f ( Chain: C, B, A, D) Nucleoporin NUP120 PDB_Info PDB_Structure Unknown Chain C = 9.9e-262 100 0 View alignment SCOP MMDB CATH Chain B = 9.9e-262 100 0 View alignment Chain A = 9.9e-262 100 0 View alignment Chain D = 9.9e-262 100 0 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP120	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YKL057C	SGD Systematic Sequence
853808	NCBI: Gene ID
NP_012866.1	NCBI: RefSeq protein version ID
NP_012866.1	NCBI: RefSeq protein version ID
6322793	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
61 curated references; 0 references not yet curated
Protein-protein Interactions	Luo Y, et al. (2010) Resolving the Composition of Protein Complexes Using a MALDI LTQ Orbitrap. J Am Soc Mass Spectrom 21(1):34-46	|APL1 |APL3 |APM4 |APS2 |ASM4 |BMH2 |EDE1 |FKS1 |NIC96 |NSP1 |NUP133 |NUP145 |NUP159 |NUP170 |MORE
Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Beliakova-Bethell N, et al. (2009) Ty3 nuclear entry is initiated by viruslike particle docking on GLFG nucleoporins. J Virol 83(22):11914-25	|NSP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP159 |NUP42 |NUP49 |NUP57 |YGR109W-A |YGR109W-B |YIL080W |YIL082W |YIL082W-A
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Dawson TR, et al. (2009) ER membrane-bending proteins are necessary for de novo nuclear pore formation. J Cell Biol 184(5):659-75	|GLE2 |NEM1 |NIC96 |NUP116 |NUP133 |NUP145 |NUP188 |NUP49 |NUP82 |NUP84 |NUP85 |POM152 |POM34 |RTN1 |MORE
Evolution Non-Fungal Related Genes/Proteins	DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30	|MLP1 |MLP2 |NIC96 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |NUP2 |NUP82 |NUP84 |NUP85
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Other Features	Fokkens L and Snel B (2009) Cohesive versus flexible evolution of functional modules in eukaryotes. PLoS Comput Biol 5(1):e1000276	|NUP145 |NUP84 |NUP85 |SEC13 |SEH1
Other Features Protein/Nucleic Acid Structure	Lezon TR, et al. (2009) Global motions of the nuclear pore complex: insights from elastic network models. PLoS Comput Biol 5(9):e1000496	|NUP145 |NUP157 |NUP170 |NUP192 |NUP84 |NUP85 |SEC13 |SEH1
Genetic Interactions	Bennett CB, et al. (2008) Yeast Screens Identify the RNA Polymerase II CTD and SPT5 as Relevant Targets of BRCA1 Interaction. PLoS ONE 3(1):e1448	|APT1 |ASM4 |ATE1 |BBC1 |BEM4 |BUR2 |CCR4 |CTK1 |DAN1 |DEF1 |DHH1 |GYP5 |HDA3 |MET18 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gonzalez-Aguilera C, et al. (2008) The THP1-SAC3-SUS1-CDC31 complex works in transcription elongation-mRNA export preventing RNA-mediated genome instability. Mol Biol Cell 19(10):4310-8	|DBP5 |GLE1 |HPR1 |MEX67 |MTR4 |NAB2 |NUP133 |NUP60 |NUP84 |PAP1 |RAT1 |RRP6 |SAC3 |SUB2 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hung NJ, et al. (2008) Arx1 Is a Nuclear Export Receptor for the 60S Ribosomal Subunit in Yeast. Mol Biol Cell 19(2):735-44	|ARX1 |CRM1 |GLE2 |MEX67 |MTR2 |NIC96 |NMD3 |NSP1 |NUP100 |NUP116 |NUP133 |NUP42 |NUP57 |NUP82 |MORE
Mutants/Phenotypes Strains/Constructs	Nagai S, et al. (2008) Functional targeting of DNA damage to a nuclear pore-associated SUMO-dependent ubiquitin ligase. Science 322(5901):597-602	|ARS607 |MEC1 |NUP133 |NUP49 |NUP60 |NUP84 |SLX5 |SLX8
Mutants/Phenotypes Strains/Constructs	Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67	|AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Mutants/Phenotypes	Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90	|ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE
Protein-protein Interactions	Tarassov K, et al. (2008) An in vivo map of the yeast protein interactome. Science 320(5882):1465-70	|ACT1 |ARC40 |ARP2 |ATG27 |BEM1 |CDC11 |CHC1 |DHH1 |FMP42 |GYL1 |KEL1 |KEL2 |LAS17 |LSM4 |MORE
Mutants/Phenotypes	Thomsen R, et al. (2008) General, rapid, and transcription-dependent fragmentation of nucleolar antigens in S. cerevisiae mRNA export mutants. RNA 14(4):706-16	|ASM4 |HPR1 |HSP104 |MEX67 |MFT1 |NOP1 |NOP58 |NSR1 |NUP100 |NUP133 |NUP159 |NUP188 |NUP2 |NUP42 |MORE
Genetic Interactions Strains/Constructs	Wilmes GM, et al. (2008) A genetic interaction map of RNA-processing factors reveals links between Sem1/Dss1-containing complexes and mRNA export and splicing. Mol Cell 32(5):735-46	|APQ12 |BRR1 |CAK1 |CBC2 |CHD1 |CSN12 |CSN9 |DBP5 |GIM4 |IST3 |ISY1 |LRP1 |MEX67 |MUD2 |MORE
Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Yao W, et al. (2008) A versatile interaction platform on the Mex67-Mtr2 receptor creates an overlap between mRNA and ribosome export. EMBO J 27(1):6-16	|MEX67 |MTR2 |NMD3 |NUP116 |NUP145 |NUP159 |NUP82 |NUP84 |NUP85 |SEC13 |SEH1
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Large-scale phenotype analysis Mutants/Phenotypes	Kitagawa T, et al. (2007) Genome-Wide Analysis of Cellular Response to Bacterial Genotoxin CdtB in Yeast. Infect Immun 75(3):1393-402	|AFT1 |ASC1 |ASF1 |BIM1 |CHL1 |CTF19 |CTF8 |DCC1 |DDC1 |DID4 |EAF1 |ELG1 |ELM1 |HUR1 |MORE
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |MORE
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs	Palancade B, et al. (2007) Nucleoporins prevent DNA damage accumulation by modulating Ulp1-dependent sumoylation processes. Mol Biol Cell 18(8):2912-23	|MRE11 |NUP133 |NUP60 |RAD27 |RAD50 |RAD51 |RAD52 |RAD54 |RAD55 |SLX5 |SLX8 |SRS2 |ULP1 |YKU70
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP157 |NUP159 |NUP170 |NUP192 |NUP2 |MORE
Regulatory Role	Sarma NJ, et al. (2007) Glucose-responsive regulators of gene expression in Saccharomyces cerevisiae function at the nuclear periphery via a reverse recruitment mechanism. Genetics 175(3):1127-35	|GAL83 |HXK2 |MIG1 |NUP133 |NUP145 |NUP84 |SEC13 |SNF1 |SNF4 |SUC2
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miao M, et al. (2006) The integral membrane protein pom34p functionally links nucleoporin subcomplexes. Genetics 172(3):1441-57	|ASM4 |GLE2 |NSP1 |NUP100 |NUP116 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP57 |NUP82 |POM152 |POM34 |MORE
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Therizols P, et al. (2006) Telomere tethering at the nuclear periphery is essential for efficient DNA double strand break repair in subtelomeric region. J Cell Biol 172(2):189-99	|ESC1 |NUP133 |NUP145 |NUP170 |NUP53 |NUP84 |SIR4 |TEL11L |YKU70
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Loeillet S, et al. (2005) Genetic network interactions among replication, repair and nuclear pore deficiencies in yeast. DNA Repair (Amst) 4(4):459-68	|NUP133 |NUP84 |RAD27 |RAD52
Protein Physical Properties Protein-protein Interactions Strains/Constructs	Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51	|GLE2 |KAP123 |MEX67 |MLP1 |NIC96 |NSP1 |NUP116 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP49 |NUP57 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Menon BB, et al. (2005) Reverse recruitment: the Nup84 nuclear pore subcomplex mediates Rap1/Gcr1/Gcr2 transcriptional activation. Proc Natl Acad Sci U S A 102(16):5749-54	|GCN4 |GCR1 |GCR2 |KAP123 |NOP1 |NUP133 |NUP145 |NUP53 |NUP84 |NUP85 |POM152 |POM34 |RAP1 |SEC13 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Palancade B, et al. (2005) Pml39, a novel protein of the nuclear periphery required for nuclear retention of improper messenger ribonucleoparticles. Mol Biol Cell 16(11):5258-68	|MLP1 |MLP2 |NAB2 |NUP133 |NUP157 |NUP60 |PML1 |PML39 |RRP6 |YRA1
Fungal Related Genes/Proteins	Bai SW, et al. (2004) The fission yeast Nup107-120 complex functionally interacts with the small GTPase Ran/Spi1 and is required for mRNA export, nuclear pore distribution, and proper cell division. Mol Cell Biol 24(14):6379-92	|GSP1 |NUP133 |NUP84 |NUP85 |SEH1
Fungal Related Genes/Proteins	Chen XQ, et al. (2004) Identification of genes encoding putative nucleoporins and transport factors in the fission yeast Schizosaccharomyces pombe: a deletion analysis. Yeast 21(6):495-509	|CSE1 |MLP1 |NUP133 |NUP2 |NUP53 |NUP84 |NUP85
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Function/Process Mutants/Phenotypes	Enyenihi AH and Saunders WS (2003) Large-scale functional genomic analysis of sporulation and meiosis in Saccharomyces cerevisiae. Genetics 163(1):47-54	|ADA2 |ADY2 |AKR1 |APS3 |APT1 |ARC1 |ARG82 |ARO2 |ATF1 |ATG11 |ATG15 |ATG16 |ATG5 |BPH1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Gao H, et al. (2003) Nuclear accumulation of the small GTPase Gsp1p depends on nucleoporins Nup133p, Rat2p/Nup120p, Nup85p, Nic96p, and the acetyl-CoA carboxylase Acc1p. J Biol Chem 278(28):25331-40	|ACC1 |GSP1 |NIC96 |NTF2 |NUP133 |NUP85 |SRM1
Protein-protein Interactions	Allen NP, et al. (2002) Deciphering networks of protein interactions at the nuclear pore complex. Mol Cell Proteomics 1(12):930-46	|CRM1 |CSE1 |GSP1 |KAP95 |MEX67 |NUP100 |NUP116 |NUP133 |NUP159 |NUP2 |NUP49 |NUP84 |NUP85 |PAB1 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Damelin M and Silver PA (2002) In situ analysis of spatial relationships between proteins of the nuclear pore complex. Biophys J 83(6):3626-36	|NIC96 |NUP116 |NUP82
RNA Levels and Processing Regulation of	Lombardia LJ, et al. (2002) Genome-wide analysis of yeast transcription upon calcium shortage. Cell Calcium 32(2):83-91	|ANR2 |APP1 |ARC40 |BAP3 |BDF1 |BIO4 |CDC14 |CDC24 |CDC6 |CHS6 |CIS3 |CPA1 |CPA2 |CSM3 |MORE
Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Lutzmann M, et al. (2002) Modular self-assembly of a Y-shaped multiprotein complex from seven nucleoporins. EMBO J 21(3):387-97	|NUP133 |NUP145 |NUP84 |NUP85 |SEC13 |SEH1
Non-Fungal Related Genes/Proteins	Belgareh N, et al. (2001) An evolutionarily conserved NPC subcomplex, which redistributes in part to kinetochores in mammalian cells. J Cell Biol 154(6):1147-60	|NUP133 |NUP84
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |MORE
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Cellular Location Function/Process Protein-protein Interactions	Siniossoglou S, et al. (2000) Structure and assembly of the Nup84p complex. J Cell Biol 149(1):41-54	|NUP145 |NUP49 |NUP84 |NUP85 |SEC13 |SEH1
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89	|CRM1 |CSE1 |DBP5 |FAL1 |GLE1 |GLE2 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR2 |MORE
Reviews	Strasser K and Hurt E (1999) Nuclear RNA export in yeast. FEBS Lett 452(1-2):77-81	|GLE1 |MEX67 |MTR10 |MTR2 |NPL3 |NSP1 |NUP145 |NUP159 |NUP82 |NUP85
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Bucci M and Wente SR (1998) A novel fluorescence-based genetic strategy identifies mutants of Saccharomyces cerevisiae defective for nuclear pore complex assembly. Mol Biol Cell 9(9):2439-61	|GLE2 |NIC96 |NSP1 |NUP116 |NUP145 |NUP159 |NUP49 |NUP57 |NUP82 |POM152
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Function/Process	Saavedra CA, et al. (1997) Yeast heat shock mRNAs are exported through a distinct pathway defined by Rip1p. Genes Dev 11(21):2845-56	|GLE1 |GSP1 |NPL3 |NUP145 |NUP159 |NUP2 |NUP42 |SSA1 |SSA4
Cellular Location Protein-protein Interactions	Teixeira MT, et al. (1997) Two functionally distinct domains generated by in vivo cleavage of Nup145p: a novel biogenesis pathway for nucleoporins. EMBO J 16(16):5086-97	|NUP100 |NUP116 |NUP145 |NUP84 |NUP85 |SEC13 |SEH1
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP133 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |NUP49 |MORE
Mutants/Phenotypes Other Features Strains/Constructs	Goldstein AL, et al. (1996) Pleiotropic nuclear defects associated with a conditional allele of the novel nucleoporin Rat9p/Nup85p. Mol Biol Cell 7(6):917-34	|NUP133 |NUP85
Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Siniossoglou S, et al. (1996) A novel complex of nucleoporins, which includes Sec13p and a Sec13p homolog, is essential for normal nuclear pores. Cell 84(2):265-75	|NUP84 |NUP85 |SEC13 |SEH1
Alias Cellular Location Fungal Related Genes/Proteins Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Strains/Constructs	Aitchison JD, et al. (1995) Nup120p: a yeast nucleoporin required for NPC distribution and mRNA transport. J Cell Biol 131(6 Pt 2):1659-75	|NUP133
Alias Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Physical Properties Strains/Constructs	Heath CV, et al. (1995) Nuclear pore complex clustering and nuclear accumulation of poly(A)+ RNA associated with mutation of the Saccharomyces cerevisiae RAT2/NUP120 gene. J Cell Biol 131(6 Pt 2):1677-97	|NUP133 |NUP159
Reviews	Pante N and Aebi U (1995) Toward a molecular understanding of the structure and function of the nuclear pore complex. Int Rev Cytol 162B:225-55

Return to SGD

Send a Message to the SGD Curators