---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

LAC1/YKL008C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXI: 428194 to 426938 CDS: 428194 - 426938 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
LAC1	YKL008C	DGT1	ORF, Verified	S000001491
Description
Ceramide synthase component, involved in synthesis of ceramide from C26(acyl)-coenzyme A and dihydrosphingosine or phytosphingosine, functionally equivalent to Lag1p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By sphingosine N-acyltransferase activity Guillas I, et al. (2001) C26-CoA-dependent ceramide synthesis of Saccharomyces cerevisiae is operated by Lag1p and Lac1p. EMBO J 20(11):2655-65        IMP : Inferred from Mutant Phenotype Assigned on 2004-02-06 SGD Schorling S, et al. (2001) Lag1p and Lac1p are essential for the Acyl-CoA-dependent ceramide synthase reaction in Saccharomyces cerevisae. Mol Biol Cell 12(11):3417-27        IMP : Inferred from Mutant Phenotype Assigned on 2004-02-06 SGD Vallee B and Riezman H (2005) Lip1p: a novel subunit of acyl-CoA ceramide synthase. EMBO J 24(4):730-41          IDA : Inferred from Direct Assay Assigned on 2005-04-19 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.3.1.24 Assigned on 2008-02-13 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2008-02-14 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By ceramide biosynthetic process Schorling S, et al. (2001) Lag1p and Lac1p are essential for the Acyl-CoA-dependent ceramide synthase reaction in Saccharomyces cerevisae. Mol Biol Cell 12(11):3417-27        IMP : Inferred from Mutant Phenotype Assigned on 2003-01-30 SGD Vallee B and Riezman H (2005) Lip1p: a novel subunit of acyl-CoA ceramide synthase. EMBO J 24(4):730-41          IDA : Inferred from Direct Assay Assigned on 2005-04-19 SGD lipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0444 Assigned on 2008-02-14 UniProtKB lipid metabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0443 Assigned on 2009-10-01 UniProtKB replicative cell aging Jiang JC, et al. (1998) Homologs of the yeast longevity gene LAG1 in Caenorhabditis elegans and human. Genome Res 8(12):1259-72        IGI : Inferred from Genetic Interaction with SGD:LAG1 , GenBank/EMBL/DDBJ:AAD16892.1 Assigned on 2007-07-02 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Jazwinski SM (2000) Metabolic control and ageing. Trends Genet 16(11):506-11        TAS : Traceable Author Statement Assigned on 2002-09-30 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2008-02-14 UniProtKB integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR016439 , EBI:IPR006634 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2009-01-12 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-02-14 UniProtKB

Pathways [TOP] [NEXT]
sphingolipid metabolism

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for LAC1/YKL008C for LAC1 LAC1 was identified as a close homolog of LAG1, a gene whose expression decreases with increasing age of yeast cells (1). A null lac1 mutant is viable, but a lac1 lag1 double deletion has been reported as lethal (1) or poor-growing (2). Human and C. elegans homologs of LAG1 have been cloned, and each is able to complement a lac1 lag1 double deletion (1). Lac1p and Lag1p have been localized to the endoplasmic reticulum, and are thought to play a role in the transport from the ER to the Golgi of glycosylphosphatidylinositol (GPI)-anchored proteins (2). LAC1 has also been called DGT1 (for "delayed GPI-anchored protein transport," 2), but is not the same as the gene on chromsome IV, MTH1, which has also been called DGT1 (for "decreasing glucose transport"). About sphingolipid metabolism Sphingolipids are essential components of the plasma membrane in all eukaryotic cells. S. cerevisiae cells make three complex sphingolipids: inositol-phosphoceramide (IPC), mannose-inositol-phosphoceramide (MIPC), and mannose-(inositol phosphate)2-ceramide (M(IP)2C)(3). In the yeast plasma membrane sphingolipids concentrate with ergosterol to form lipid rafts, specialized membrane microdomains implicated in a variety of cellular processes, including sorting of membrane proteins and lipids, as well as organizing and regulating signaling cascades (4). Intermediates in sphingolipid biosynthesis have been shown to play important roles as signaling molecules and growth regulators. Sphingolipid long chain bases (LCBs), dihydrosphingosine (DHS) and phytosphingosine (PHS), have been implicated as secondary messengers in signaling pathways that regulate heat stress response (5, 6). Other intermediates, phytoceramide and long-chain base phosphates (LCBPs), have been shown to be components of the tightly-controlled ceramide/LCBP rheostat, which regulates cell growth (7). Since phosphoinositol-containing sphingolipids are unique to fungi, the sphingolipid biosynthesis pathway is considered a target for antifungal drugs (8, 9). Last Updated: 2007-10-05

Basic References [TOP]

BASIC INFORMATION REFERENCES forLAC1/YKL008C for LAC1 1) Jiang JC, et al. (1998) Homologs of the yeast longevity gene LAG1 in Caenorhabditis elegans and human. Genome Res 8(12):1259-72        2) Barz WP and Walter P (1999) Two endoplasmic reticulum (ER) membrane proteins that facilitate ER-to-Golgi transport of glycosylphosphatidylinositol-anchored proteins. Mol Biol Cell 10(4):1043-59        3) Dickson RC and Lester RL (2002) Sphingolipid functions in Saccharomyces cerevisiae. Biochim Biophys Acta 1583(1):13-25            4) Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80        5) Jenkins GM, et al. (1997) Involvement of yeast sphingolipids in the heat stress response of Saccharomyces cerevisiae. J Biol Chem 272(51):32566-72        6) Ferguson-Yankey SR, et al. (2002) Mutant analysis reveals complex regulation of sphingolipid long chain base phosphates and long chain bases during heat stress in yeast. Yeast 19(7):573-86      7) Kobayashi SD and Nagiec MM (2003) Ceramide/long-chain base phosphate rheostat in Saccharomyces cerevisiae: regulation of ceramide synthesis by Elo3p and Cka2p. Eukaryot Cell 2(2):284-94        8) Nagiec MM, et al. (1997) Sphingolipid synthesis as a target for antifungal drugs. Complementation of the inositol phosphorylceramide synthase defect in a mutant strain of Saccharomyces cerevisiae by the AUR1 gene. J Biol Chem 272(15):9809-17        9) Sugimoto Y, et al. (2004) IPC synthase as a useful target for antifungal drugs. Curr Drug Targets Infect Disord 4(4):311-22        10) Jazwinski SM (2002) Growing old: metabolic control and yeast aging. Annu Rev Microbiol 56:769-92

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for LAC1/YKL008C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for LAC1/YKL008C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSTIKPS C-term TPTKKDI Length(aa) 418 MW(Da) 48,992 pI 10.28 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.184   Codon Adaptation Index 0.195   Frequency of Optimal Codons 0.520   Hydropathicity of Protein 0.064   Aromaticity Score 0.163

10 20 30 40 50 | | | | | MSTIKPSPSNNNLKVRSRPRRKSSIGKIDLGDTVPSLGTMFETKESKTAA KRRMQRLSEATKNDSDLVKKIWFSFREISYRHAWIAPLMILIAVYSAYFT SGNTTKTNVLHRFVAVSYQIGDTNAYGKGINDLCFVFYYMIFFTFLREFL MDVVIRPFAIRLHVTSKHRIKRIMEQMYAIFYTGVSGPFGIYCMYHSDLW FFNTKAMYRTYPDFTNPFLFKVFYLGQAAFWAQQACILVLQLEKPRKDHN ELTFHHIVTLLLIWSSYVFHFTKMGLPIYITMDVSDFLLSFSKTLNYLDS GLAFFSFAIFVVAWIYLRHYINLKILWSVLTQFRTEGNYVLNFATQQYKC WISLPIVFVLIGALQLVNLYWLFLIFRVLYRILWRGILKDDRSDSESDEE SDESSTTPTDSTPTKKDI*

Protein Structures from PDB: proteins of known structure with sequence similarity to LAC1/YKL008C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
LAC1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YKL008C	SGD Systematic Sequence
853861	NCBI: Gene ID
NP_012917.1	NCBI: RefSeq protein version ID
NP_012917.1	NCBI: RefSeq protein version ID
6322844	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
35 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Cerantola V, et al. (2009) Aureobasidin A arrests growth of yeast cells through both ceramide intoxication and deprivation of essential inositolphosphorylceramides. Mol Microbiol 71(6):1523-37	|AUR1 |LAG1 |YDC1 |YPC1
Disease Gene Related Reviews	Ozbayraktar FB and Ulgen KO (2009) Molecular facets of sphingolipids: mediators of diseases. Biotechnol J 4(7):1028-41	|AUR1 |CSG2 |CSH1 |IPT1 |ISC1 |LAG1 |LCB1 |LCB2 |LCB4 |LCB5 |SCS7 |SUR1 |SUR2 |TSC10 |MORE
RNA Levels and Processing	Pedroso N, et al. (2009) Modulation of plasma membrane lipid profile and microdomains by H(2)O(2) in Saccharomyces cerevisiae. Free Radic Biol Med 46(2):289-98	|ACC1 |ELO1 |ERG1 |ERG25 |ERG3 |ERG6 |ERG7 |FAS1 |FEN1 |GPT2 |LIP1 |OLE1 |RAD27 |SUR4
Disease Gene Related Non-Fungal Related Genes/Proteins Reviews	Teufel A, et al. (2009) The longevity assurance homologue of yeast lag1 (Lass) gene family (Review). Int J Mol Med 23(2):135-40	|LAG1
RNA Levels and Processing Regulation of	Guo N, et al. (2008) Global gene expression profile of Saccharomyces cerevisiae induced by dictamnine. Yeast 25(9):631-41	|ADE1 |ADE12 |ADE13 |ADE16 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADE8 |ADY2 |APT1 |CBF1 |CIS3 |MORE
Cross-species Expression Fungal Related Genes/Proteins	Takakuwa N, et al. (2008) Significance of the KlLAC1 gene in glucosylceramide production by Kluyveromyces lactis. FEMS Yeast Res 8(6):839-45	|LAG1
Computational analysis	Alvarez-Vasquez F, et al. (2007) Coordination of the dynamics of yeast sphingolipid metabolism during the diauxic shift. Theor Biol Med Model 4:42	|AUR1 |DPP1 |ELO1 |FAS1 |FAS2 |FEN1 |GPT2 |IPT1 |LAG1 |LCB1 |LCB2 |LCB4 |LCB5 |LIP1 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Cerantola V, et al. (2007) Yeast sphingolipids do not need to contain very long chain fatty acids. Biochem J 401(1):205-216	|LAG1 |LIP1 |YDC1 |YPC1
Reviews	Cowart LA and Obeid LM (2007) Yeast sphingolipids: recent developments in understanding biosynthesis, regulation, and function. Biochim Biophys Acta 1771(3):421-31	|AUR1 |CSG2 |CSH1 |DPL1 |FEN1 |ISC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |SUR1 |SUR4 |MORE
Reviews	Kihara A, et al. (2007) Metabolism and biological functions of two phosphorylated sphingolipids, sphingosine 1-phosphate and ceramide 1-phosphate. Prog Lipid Res 46(2):126-44	|DPL1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |SUR2 |TSC10 |TSC3 |YDC1 |YPC1 |YSR3
Cellular Location Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs Techniques and Reagents	Kageyama-Yahara N and Riezman H (2006) Transmembrane topology of ceramide synthase in yeast. Biochem J 398(3):585-93	|LAG1
Mutants/Phenotypes Strains/Constructs	Meier KD, et al. (2006) Sphingoid base is required for translation initiation during heat stress in Saccharomyces cerevisiae. Mol Biol Cell 17(3):1164-75	|EAP1 |HSP26 |LAG1 |LCB1 |LCB4 |LCB5 |MSN2 |PKH1 |PKH2 |SSA1 |UBI4 |YPK1 |YPK2
Reviews	Riezman H (2006) Organization and functions of sphingolipid biosynthesis in yeast. Biochem Soc Trans 34(3):367-369	|AUR1 |CSG2 |DPL1 |IPT1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |SUR1 |SUR2 |TSC3 |MORE
Cross-species Expression Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins	Yu Y, et al. (2006) Expression of LASS2 controlled by LAG1 or ADH1 promoters cannot functionally complement Lag1p. Microbiol Res 161(3):203-11	|LAG1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22	|ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |CSG2 |DPL1 |ELO1 |ERG24 |ERG3 |ERG4 |ERG5 |FEN1 |HEM1 |MORE
Protein-protein Interactions	Millson SH, et al. (2005) A two-hybrid screen of the yeast proteome for Hsp90 interactors uncovers a novel Hsp90 chaperone requirement in the activity of a stress-activated mitogen-activated protein kinase, Slt2p (Mpk1p). Eukaryot Cell 4(5):849-60	|ACF4 |ACT1 |AGP2 |AHA1 |AIM2 |AIM37 |ANT1 |AQR1 |ARE1 |ARE2 |ARG4 |ARR3 |ASG7 |ATG14 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs Techniques and Reagents	Vallee B and Riezman H (2005) Lip1p: a novel subunit of acyl-CoA ceramide synthase. EMBO J 24(4):730-41	|LAG1 |LIP1
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein-protein Interactions	Jiang JC, et al. (2004) Suppressor analysis points to the subtle role of the LAG1 ceramide synthase gene in determining yeast longevity. Exp Gerontol 39(7):999-1009	|LAG1 |YDC1 |YPC1
DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Regulation of Strains/Constructs Transcription	Kolaczkowski M, et al. (2004) Differential regulation of ceramide synthase components LAC1 and LAG1 in Saccharomyces cerevisiae. Eukaryot Cell 3(4):880-92	|CBF1 |LAG1 |LCB2 |PDR1 |PDR3 |ROX1 |SUR2
Cross-species Expression Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Guillas I, et al. (2003) Human homologues of LAG1 reconstitute Acyl-CoA-dependent ceramide synthesis in yeast. J Biol Chem 278(39):37083-91	|LAG1
Reviews	Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80	|AUR1 |CSG2 |IPT1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |SUR1 |SUR2 |TSC10 |YSR3
Reviews	Funato K, et al. (2002) Biosynthesis and trafficking of sphingolipids in the yeast Saccharomyces cerevisiae. Biochemistry 41(51):15105-14	|ACB1 |AUR1 |CCC2 |CSG2 |DPL1 |ELO1 |FEN1 |FMP45 |IFA38 |IPT1 |ISC1 |LAG1 |LCB1 |LCB2 |MORE
Reviews	Hannun YA and Obeid LM (2002) The Ceramide-centric universe of lipid-mediated cell regulation: stress encounters of the lipid kind. J Biol Chem 277(29):25847-50	|LAG1
Function/Process Protein Sequence Features	Venkataraman K, et al. (2002) Upstream of growth and differentiation factor 1 (uog1), a mammalian homolog of the yeast longevity assurance gene 1 (LAG1), regulates N-stearoyl-sphinganine (C18-(dihydro)ceramide) synthesis in a fumonisin B1-independent manner in mammalian cells. J Biol Chem 277(38):35642-9	|LAG1
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Guillas I, et al. (2001) C26-CoA-dependent ceramide synthesis of Saccharomyces cerevisiae is operated by Lag1p and Lac1p. EMBO J 20(11):2655-65	|LAG1
DNA/RNA Sequence Features Regulation of Transcription	Iyer VR, et al. (2001) Genomic binding sites of the yeast cell-cycle transcription factors SBF and MBF. Nature 409(6819):533-8	|ABF1 |APN1 |BBP1 |BUD9 |CAP1 |CDC21 |CDC45 |CDC7 |CLA4 |CLB1 |CLB2 |CLB6 |CLD1 |CLN1 |MORE
Reviews	Jazwinski SM (2001) New clues to old yeast. Mech Ageing Dev 122(9):865-82	|LAG1
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Schorling S, et al. (2001) Lag1p and Lac1p are essential for the Acyl-CoA-dependent ceramide synthase reaction in Saccharomyces cerevisae. Mol Biol Cell 12(11):3417-27	|LAG1 |YDC1 |YPC1
Reviews	Jazwinski SM (2000) Metabolic control and ageing. Trends Genet 16(11):506-11	|LAG1 |RTG1 |RTG2 |RTG3
Alias Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins	Barz WP and Walter P (1999) Two endoplasmic reticulum (ER) membrane proteins that facilitate ER-to-Golgi transport of glycosylphosphatidylinositol-anchored proteins. Mol Biol Cell 10(4):1043-59	|LAG1
Reviews	Sinclair DA (1999) Yeast aging research: recent advances and medical relevance. Cell Mol Life Sci 56(9-10):807-16	|LAG1 |LAG2 |RAS2 |RTG2 |SGS1 |SIR2 |SIR3 |SIR4
Cross-species Expression Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Jiang JC, et al. (1998) Homologs of the yeast longevity gene LAG1 in Caenorhabditis elegans and human. Genome Res 8(12):1259-72	|LAG1
Reviews	Jazwinski SM (1996) Longevity, genes, and aging. Science 273(5271):54-9	|LAG1 |PHB1 |PHB2
DNA/RNA Sequence Features Mapping RNA Levels and Processing	Fairhead C and Dujon B (1994) Transcript map of two regions from chromosome XI of Saccharomyces cerevisiae for interpretation of systematic sequencing results. Yeast 10(11):1403-13	|ABF1 |APN1 |ARC19 |BYE1 |CAP1 |CCE1 |DGR2 |KTI12 |MRT4 |OAC1 |PRP40 |PRR1 |RAD27 |RPL14A |MORE
DNA/RNA Sequence Features Mapping	Boyer J, et al. (1993) Sequence of a 7.8 kb segment on the left arm of yeast chromosome XI reveals four open reading frames, including the CAP1 gene, an intron-containing gene and a gene encoding a homolog to the mammalian UOG-1 gene. Yeast 9(3):279-87	|CAP1 |DST1

Return to SGD

Send a Message to the SGD Curators