GTT1/YIR038C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIX: 424510 to 423806
CDS: 424510 - 423806

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

GTT1 YIR038C ORF, Verified S000001477

Description
ER associated glutathione S-transferase capable of homodimerization; expression induced during the diauxic shift and throughout stationary phase; functional overlap with Gtt2p, Grx1p, and Grx2p

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
glutathione peroxidase activity Garcera A, et al. (2006) Saccharomyces cerevisiae cells have three Omega class glutathione S-transferases acting as 1-Cys thiol transferases. Biochem J 398(2):187-96
       IDA : Inferred from Direct Assay
Assigned on 2007-01-04 SGD
glutathione transferase activity Choi JH, et al. (1998) A novel membrane-bound glutathione S-transferase functions in the stationary phase of the yeast Saccharomyces cerevisiae. J Biol Chem 273(45):29915-22
       IDA : Inferred from Direct Assay
ISS : Inferred from Sequence or structural Similarity
Assigned on 2002-10-03 SGD
GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
     IEA : Inferred from Electronic Annotation with IUBMB:2.5.1.18
Assigned on 2007-05-23 UniProtKB
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cellular response to heat Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439
       RCA : Reviewed Computational Analysis
Assigned on 2009-03-03 SGD
glutathione metabolic process Choi JH, et al. (1998) A novel membrane-bound glutathione S-transferase functions in the stationary phase of the yeast Saccharomyces cerevisiae. J Biol Chem 273(45):29915-22
       IDA : Inferred from Direct Assay
Assigned on 2002-10-03 SGD
vacuolar protein catabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Choi JH, et al. (1998) A novel membrane-bound glutathione S-transferase functions in the stationary phase of the yeast Saccharomyces cerevisiae. J Biol Chem 273(45):29915-22
       IDA : Inferred from Direct Assay
Assigned on 2002-10-03 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
extrinsic to membrane GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9903
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
mitochondrial outer membrane Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50
         IDA : Inferred from Direct Assay
Assigned on 2006-03-17 SGD
mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
         IDA : Inferred from Direct Assay
Assigned on 2004-09-28 SGD
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
           IDA : Inferred from Direct Assay
Assigned on 2006-12-12 SGD
plasma membrane enriched fraction Delom F, et al. (2006) The plasma membrane proteome of Saccharomyces cerevisiae and its response to the antifungal calcofluor. Proteomics 6(10):3029-39
       IDA : Inferred from Direct Assay
Assigned on 2009-04-29 SGD

Pathways [TOP] [NEXT]
glutathione-glutaredoxin redox reactions

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forGTT1/YIR038C for GTT1
1) Choi JH, et al. (1998) A novel membrane-bound glutathione S-transferase functions in the stationary phase of the yeast Saccharomyces cerevisiae. J Biol Chem 273(45):29915-22

2) Collinson EJ and Grant CM (2003) Role of yeast glutaredoxins as glutathione S-transferases. J Biol Chem 278(25):22492-7

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GTT1/YIR038C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GTT1/YIR038C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSLPIIK

C-term RALGSNF

Length(aa) 234

MW(Da) 26,795

pI 6.65

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.262

Codon Adaptation Index 0.234

Frequency of Optimal Codons 0.556

Hydropathicity of Protein -0.253

Aromaticity Score 0.120

10 20 30 40 50 | | | | | MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPELKKI HPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMSEDADIA DQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARKVADKISQA YSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFPLQMAFERKFAA PEDYPAISKWLKTITSEESYAASKEKARALGSNF*

Protein Structures from PDB: proteins of known structure with sequence similarity to GTT1/YIR038C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
GTT1 Choi JH, et al. (1998) A novel membrane-bound glutathione S-transferase functions in the stationary phase of the yeast Saccharomyces cerevisiae. J Biol Chem 273(45):29915-22

Standard Name	Reference
GTT1	*Choi JH, et al.* (1998)** A novel membrane-bound glutathione S-transferase functions in the stationary phase of the yeast Saccharomyces cerevisiae. J Biol Chem 273(45):29915-22

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YIR038C SGD Systematic Sequence

854856 NCBI: Gene ID

NP_012304.1 NCBI: RefSeq protein version ID

NP_012304.1 NCBI: RefSeq protein version ID

6322229 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YIR038C	SGD Systematic Sequence
854856	NCBI: Gene ID
NP_012304.1	NCBI: RefSeq protein version ID
NP_012304.1	NCBI: RefSeq protein version ID
6322229	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
DNA & RNA Details
Topic Research Highlight Reference Contributor
Other DNA & RNA Details Description: Specifically higher expression in carbon limited chemostat cultures versus carbon excess.
otherTopic: expression
Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74
Viktor Boer
2003-07-25

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
35 curated references; 0 references not yet curated
Regulation of
Zeng T and Li J (2010) Maximization of negative correlations in time-course gene expression data for enhancing understanding of molecular pathways. Nucleic Acids Res 38(1):e1
       |ACO2 |ADR1 |CAB2 |CAT8 |CIT1 |ERG2 |ERG26 |ERG27 |ERG4 |ERG5 |ERG6 |GCN4 |HAP1 |HAP3 |MORE
Mutants/Phenotypes
Adamis PD, et al. (2009) Glutathione and gamma-glutamyl transferases are involved in the formation of cadmium-glutathione complex. FEBS Lett 583(9):1489-92
       |ECM38 |GSH1 |GTT2 |YCF1
Function/Process
Mutants/Phenotypes
Todorova TT, et al. (2009) Response to different oxidants of Saccharomyces cerevisiae ure2Delta mutant. Arch Microbiol 191(11):837-45
       |CTA1 |GPX1 |GPX2 |GTT2 |HYR1 |SOD1 |SOD2 |URE2
Transcription
Yasokawa D, et al. (2009) Toxicity of Methanol and Formaldehyde Towards Saccharomyces cerevisiae as Assessed by DNA Microarray Analysis. Appl Biochem Biotechnol
       |AAD10 |AAD14 |AAD16 |AAD3 |AAD6 |ADH1 |ADH2 |ADH5 |ADH7 |AGP2 |ALD2 |ALD3 |ALD4 |ALD6 |MORE
Mutants/Phenotypes
Strains/Constructs
Aragon AD, et al. (2008) Characterization of differentiated quiescent and nonquiescent cells in yeast stationary-phase cultures. Mol Biol Cell 19(3):1271-80
           |ARD1 |ATP1 |ATP2 |DDR2 |DOA4 |ETR1 |FMP45 |GPD1 |GPG1 |ICL1 |JEN1 |MDH1 |NAT1 |OM14 |MORE
Mutants/Phenotypes
Strains/Constructs
Castro FA, et al. (2008) Cytotoxicity Mechanism of Two Naphthoquinones (Menadione and Plumbagin) in Saccharomyces cerevisiae. PLoS ONE 3(12):e3999
           |ECM4 |GTT2
Function/Process
Mutants/Phenotypes
Strains/Constructs
Mariani D, et al. (2008) Involvement of glutathione transferases, Gtt1and Gtt2, with oxidative stress response generated by H(2)O(2) during growth of Saccharomyces cerevisiae. Redox Rep 13(6):246-254
     |GTT2
Mutants/Phenotypes
Strains/Constructs
Seitomer E, et al. (2008) Analysis of Saccharomyces cerevisiae null allele strains identifies a larger role for DNA damage versus oxidative stress pathways in growth inhibition by selenium. Mol Nutr Food Res 52(11):1305-15
       |AHP1 |ASF1 |BMH1 |BMH2 |CCP1 |CHK1 |CSM3 |CTA1 |CTT1 |DDC1 |DUN1 |GLR1 |GPX1 |GPX2 |MORE
Regulation of
Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439
       |ADD37 |AFR1 |AGX1 |AHA1 |AIM17 |ALD4 |ALG13 |ARA1 |ASI1 |ATG12 |ATG8 |BAG7 |BDH1 |CAD1 |MORE
Genetic Interactions
Infection and Antifungals
Mutants/Phenotypes
Strains/Constructs
Castro FA, et al. (2007) Menadione stress in Saccharomyces cerevisiae strains deficient in the glutathione transferases. Biochim Biophys Acta 1770(2):213-20
       |GTT2
Cellular Location
Sarry JE, et al. (2007) Analysis of the vacuolar luminal proteome of Saccharomyces cerevisiae. FEBS J 274(16):4287-305
       |AAT2 |ACH1 |ACO1 |ACS2 |ACT1 |ADE13 |ADH1 |ADH2 |ADO1 |AEP3 |ALD6 |AMS1 |ANB1 |APE3 |MORE
Mutants/Phenotypes
Transcription
Barreto L, et al. (2006) A Peroxisomal Glutathione Transferase of Saccharomyces cerevisiae Is Functionally Related to Sulfur Amino Acid Metabolism. Eukaryot Cell 5(10):1748-59
         |CHA1 |ECM4 |GAP1 |GTO1 |GTO3 |GTT2 |MET6 |MSN2 |MSN4 |STR3 |YAP1
Regulation of
Transcription
Fry RC, et al. (2006) The DNA-damage signature in Saccharomyces cerevisiae is associated with single-strand breaks in DNA. BMC Genomics 7():313
         |AAH1 |AHP1 |ALG14 |AMN1 |ASF1 |BAT1 |BUD4 |CAC2 |CAR1 |CDC42 |CDC8 |CHA1 |CHS2 |CIC1 |MORE
Function/Process
Protein Physical Properties
Strains/Constructs
Substrates/Ligands/Cofactors
Garcera A, et al. (2006) Saccharomyces cerevisiae cells have three Omega class glutathione S-transferases acting as 1-Cys thiol transferases. Biochem J 398(2):187-96
       |ECM4 |GRX5 |GTO1 |GTO3
RNA Levels and Processing
Guo Y, et al. (2006) Analysis of cellular responses to aflatoxin B(1) in yeast expressing human cytochrome P450 1A2 using cDNA microarrays. Mutat Res 593(1-2):121-42
           |AAT1 |AHA1 |ALD2 |ALD3 |ALK1 |APC1 |APC5 |APT2 |AQR1 |AQY2 |ARC40 |ARN1 |ARO10 |ARO9 |MORE
Reviews
Herrero E, et al. (2006) Glutaredoxins in fungi. Photosynth Res 89(2):127-40
     |AFT1 |GRX1 |GRX2 |GRX3 |GRX4 |GRX5 |GTT2
Cellular Location
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
           |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Fungal Related Genes/Proteins
Sellam A, et al. (2006) Molecular cloning of AbGst1 encoding a glutathione transferase differentially expressed during exposure of Alternaria brassicicola to isothiocyanates. FEMS Microbiol Lett 258(2):241-9

Cellular Location
Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50
         |AFG1 |AIM18 |ALD4 |ALO1 |ATP15 |ATP2 |ATP3 |ATP5 |AYR1 |BNA4 |CBR1 |CIR1 |COR1 |CYB2 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Rai R and Cooper TG (2005) In vivo specificity of Ure2 protection from heavy metal ion and oxidative cellular damage in Saccharomyces cerevisiae. Yeast 22(5):343-58
       |ECM38 |GRX1 |GRX2 |GTT2 |URE2
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Adamis PD, et al. (2004) The role of glutathione transferases in cadmium stress. Toxicol Lett 154(1-2):81-8
       |GTT2
Function/Process
Mutants/Phenotypes
Strains/Constructs
Basu U, et al. (2004) Reverse genetic analysis of the glutathione metabolic pathway suggests a novel role of PHGPX and URE2 genes in aluminum resistance in Saccharomyces cerevisiae. Mol Genet Genomics 271(5):627-37
       |GLR1 |GPX1 |GPX2 |GSH1 |GSH2 |GTT2 |HYR1 |OPT1 |URE2
Regulation of
Transcription
Fujita K, et al. (2004) Comprehensive gene expression analysis of the response to straight-chain alcohols in Saccharomyces cerevisiae using cDNA microarray. J Appl Microbiol 97(1):57-67
               |CTT1 |CYC7 |DAK1 |DDR2 |DDR48 |FUM1 |GRE3 |GRX1 |HOR7 |HSC82 |HSP104 |HSP12 |HSP26 |HSP30 |MORE
Genomic expression study
RNA Levels and Processing
Kim HJ, et al. (2004) A yeast DNA microarray for the evaluation of toxicity in environmental water containing burned ash. Environ Monit Assess 92(1-3):253-72
               |AAH1 |ATC1 |ATO2 |BOP2 |CAD1 |CCL1 |CCP1 |CDC42 |CRS5 |CSR2 |CTA1 |CTT1 |CUP1-1 |CUP1-2 |MORE
Cell Cycle Phase Involved
Function/Process
Mutants/Phenotypes
RNA Levels and Processing
Strains/Constructs
Martinez MJ, et al. (2004) Genomic analysis of stationary-phase and exit in Saccharomyces cerevisiae: gene expression and identification of novel essential genes. Mol Biol Cell 15(12):5295-305
           |AAH1 |ADY2 |ALD2 |ATP1 |ATP18 |ATP2 |ATP3 |CIT1 |COX6 |COX7 |ETR1 |FMP45 |GCR1 |GCS1 |MORE
Genomic expression study
RNA Levels and Processing
Regulation of
Parveen M, et al. (2004) Response of Saccharomyces cerevisiae to a monoterpene: evaluation of antifungal potential by DNA microarray analysis. J Antimicrob Chemother 54(1):46-55
               |AAD6 |ADH5 |ADH7 |ADY2 |AGA2 |AMS1 |ARG1 |ARN2 |ATF2 |ATX1 |BCK1 |BFR1 |BSC1 |BUD7 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Collinson EJ and Grant CM (2003) Role of yeast glutaredoxins as glutathione S-transferases. J Biol Chem 278(25):22492-7
       |GRX1 |GRX2 |GTT2
Other Features
Sharma KG, et al. (2003) The glutathione-mediated detoxification pathway in yeast: an analysis using the red pigment that accumulates in certain adenine biosynthetic mutants of yeasts reveals the involvement of novel genes. Arch Microbiol 180(2):108-17
     |ADE1 |ADE2 |BPT1 |GTT2 |SKN7 |YBT1 |YCF1 |YCK1
Cellular Location
Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
         |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Mutants/Phenotypes
Willingham S, et al. (2003) Yeast genes that enhance the toxicity of a mutant huntingtin fragment or alpha-synuclein. Science 302(5651):1769-72
           |ABZ2 |AIM46 |ALB1 |APE2 |APJ1 |APM2 |ARL3 |ARO1 |ATG15 |AYR1 |CIT2 |CMK1 |COG6 |COS111 |MORE
Function/Process
Collinson EJ, et al. (2002) The yeast glutaredoxins are active as glutathione peroxidases. J Biol Chem 277(19):16712-7
       |GPX1 |GPX2 |GRX1 |GRX2 |GTT2 |HYR1 |YCF1
Fungal Related Genes/Proteins
Shin YH, et al. (2002) Characterization, expression and regulation of a third gene encoding glutathione S-transferase from the fission yeast. Biochim Biophys Acta 1577(1):164-70
       |GRX1 |GRX2 |GTT2
Regulation of
Transcription
Schaus SE, et al. (2001) Gene transcription analysis of Saccharomyces cerevisiae exposed to neocarzinostatin protein-chromophore complex reveals evidence of DNA damage, a potential mechanism of resistance, and consequences of prolonged exposure. Proc Natl Acad Sci U S A 98(20):11075-80
           |ACS1 |AQR1 |DDR2 |DDR48 |FBP1 |HSP12 |ICL1 |IDP2 |JEN1 |LAP3 |MEC1 |MLS1 |NCE102 |NCE103 |MORE
RNA Levels and Processing
Regulation of
Jelinsky SA and Samson LD (1999) Global response of Saccharomyces cerevisiae to an alkylating agent. Proc Natl Acad Sci U S A 96(4):1486-91
             |AAD14 |AAD16 |AAD4 |AAD6 |ABF1 |ADP1 |AGX1 |AMD2 |ARG1 |ARG3 |ARG4 |ARG5,6 |ARG7 |ARO1 |MORE
Cellular Location
DNA/RNA Sequence Features
Function/Process
Mutants/Phenotypes
Strains/Constructs
Choi JH, et al. (1998) A novel membrane-bound glutathione S-transferase functions in the stationary phase of the yeast Saccharomyces cerevisiae. J Biol Chem 273(45):29915-22
       |GTT2 |URE2

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.