SEC11/YIR022W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIX: 398730 to 399233
CDS: 398730 - 399233
Genetic position: 22 cM

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

SEC11 YIR022W ORF, Verified S000001461

Description
18kDa catalytic subunit of the Signal Peptidase Complex (SPC; Spc1p, Spc2p, Spc3p, and Sec11p) which cleaves the signal sequence of proteins targeted to the endoplasmic reticulum

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0378
Assigned on 2007-05-23 UniProtKB
peptidase activity VanValkenburgh C, et al. (1999) The catalytic mechanism of endoplasmic reticulum signal peptidase appears to be distinct from most eubacterial signal peptidases. J Biol Chem 274(17):11519-25
       ISS : Inferred from Sequence or structural Similarity
IMP : Inferred from Mutant Phenotype
Assigned on 2001-01-18 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001733
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0645
Assigned on 2007-05-23 UniProtKB
serine-type peptidase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR019758 , EBI:IPR019756
Assigned on 2009-10-01 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
peptide metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
protein maturation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
protein processing Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
protein targeting to ER Bohni PC, et al. (1988) SEC11 is required for signal peptide processing and yeast cell growth. J Cell Biol 106(4):1035-42
     IMP : Inferred from Mutant Phenotype
Assigned on 2006-08-07 SGD
proteolysis DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001733
Assigned on 2009-03-04 UniProtKB
signal peptide processing Bohni PC, et al. (1988) SEC11 is required for signal peptide processing and yeast cell growth. J Cell Biol 106(4):1035-42
     IMP : Inferred from Mutant Phenotype
Assigned on 2001-01-18 SGD
YaDeau JT, et al. (1991) Yeast signal peptidase contains a glycoprotein and the Sec11 gene product. Proc Natl Acad Sci U S A 88(2):517-21
       IPI : Inferred from Physical Interaction
Assigned on 2001-01-18 SGD
VanValkenburgh C, et al. (1999) The catalytic mechanism of endoplasmic reticulum signal peptidase appears to be distinct from most eubacterial signal peptidases. J Biol Chem 274(17):11519-25
       ISS : Inferred from Sequence or structural Similarity
IMP : Inferred from Mutant Phenotype
IDA : Inferred from Direct Assay
Assigned on 2001-01-18 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001733
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Chen X, et al. (2001) Signal peptidase and oligosaccharyltransferase interact in a sequential and dependent manner within the endoplasmic reticulum. J Biol Chem 276(4):2411-6
       IDA : Inferred from Direct Assay
Assigned on 2002-08-22 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR019758 , EBI:IPR019756
Assigned on 2009-10-01 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9906
Assigned on 2009-10-01 UniProtKB
membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001733
Assigned on 2009-03-04 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-03-04 UniProtKB
signal peptidase complex YaDeau JT, et al. (1991) Yeast signal peptidase contains a glycoprotein and the Sec11 gene product. Proc Natl Acad Sci U S A 88(2):517-21
       IDA : Inferred from Direct Assay
Assigned on 2001-01-18 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for SEC11/YIR022W for SEC11
SEC11 encodes the catalytic subunit of the signal peptidase complex (SPC), which cleaves the signal sequence from proteins targeted to the endoplasmic reticulum (ER) (1, 2). Signal peptide cleavage occurs concomitantly with translocation through the translocon pore into the ER. In yeast, translocation can occur cotranslationally or posttranslationally, whereas in mammals translocation is always cotranslational. The process of protein translocation into the ER is reviewed in references 3 and 4.
The yeast SPC comprises four proteins, Spc1p, Spc2p, Spc3p, and Sec11p (2, 5). SEC11 is essential for viability and for signal peptidase activity (1). SEC11 interacts genetically with the genes encoding the other SPC subunits (6, 7, 8), and Sec11p can be coimmunoprecipitated with Spc3p (9).
Sec11p is homologous to the mammalian signal peptidase subunits SPC18 and SPC21 (10), and shows some sequence similarity the catalytic site of the Bacillus subtilis leader peptidase SipW (9). Indeed, Sec11p has signal peptidase catalytic activity, although the phenotypes of mutations in the putative catalytic site of Sec11p suggest that the catalytic mechanism of Sec11p differs from that of SipW (9).
Last Updated: 2000-12-08

Basic References [TOP]
BASIC INFORMATION REFERENCES forSEC11/YIR022W for SEC11
1) Bohni PC, et al. (1988) SEC11 is required for signal peptide processing and yeast cell growth. J Cell Biol 106(4):1035-42

2) YaDeau JT, et al. (1991) Yeast signal peptidase contains a glycoprotein and the Sec11 gene product. Proc Natl Acad Sci U S A 88(2):517-21

3) Rapoport TA, et al. (1996) Protein transport across the eukaryotic endoplasmic reticulum and bacterial inner membranes. Annu Rev Biochem 65:271-303

4) Johnson AE and van Waes MA (1999) The translocon: a dynamic gateway at the ER membrane. Annu Rev Cell Dev Biol 15:799-842

5) Antonin W, et al. (2000) Interactions between Spc2p and other components of the endoplasmic reticulum translocation sites of the yeast Saccharomyces cerevisiae. J Biol Chem 275(44):34068-72

6) Mullins C, et al. (1996) Structurally related Spc1p and Spc2p of yeast signal peptidase complex are functionally distinct. J Biol Chem 271(46):29094-9

7) Fang H, et al. (1996) The homologue of mammalian SPC12 is important for efficient signal peptidase activity in Saccharomyces cerevisiae. J Biol Chem 271(28):16460-5

8) Fang H, et al. (1997) In addition to SEC11, a newly identified gene, SPC3, is essential for signal peptidase activity in the yeast endoplasmic reticulum. J Biol Chem 272(20):13152-8

9) VanValkenburgh C, et al. (1999) The catalytic mechanism of endoplasmic reticulum signal peptidase appears to be distinct from most eubacterial signal peptidases. J Biol Chem 274(17):11519-25

10) Shelness GS and Blobel G (1990) Two subunits of the canine signal peptidase complex are homologous to yeast SEC11 protein. J Biol Chem 265(16):9512-9

11) Novick P and Schekman R (1979) Secretion and cell-surface growth are blocked in a temperature-sensitive mutant of Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 76(4):1858-62

12) Novick P, et al. (1980) Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SEC11/YIR022W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SEC11/YIR022W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MNLRFEL

C-term SALLGGE

Length(aa) 167

MW(Da) 18,762

pI 9.96

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.165

Codon Adaptation Index 0.165

Frequency of Optimal Codons 0.500

Hydropathicity of Protein 0.090

Aromaticity Score 0.120

10 20 30 40 50 | | | | | MNLRFELQKLLNVCFLFASAYMFWQGLAIATNSASPIVVVLSGSMEPAFQ RGDILFLWNRNTFNQVGDVVVYEVEGKQIPIVHRVLRQHNNHADKQFLLT KGDNNAGNDISLYANKKIYLNKSKEIVGTVKGYFPQLGYITIWISENKYA KFALLGMLGLSALLGGE*

Protein Structures from PDB: proteins of known structure with sequence similarity to SEC11/YIR022W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
SEC11 Novick P, et al. (1980) Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15

Mapping Notes
Date Note
1992-10-01 Edition 11: sec11 has been physically mapped and is proximal and adjacent to dal81
Mortimer RK, et al. (1992) Genetic and physical maps of Saccharomyces cerevisiae, Edition 11. Yeast 8(10):817-902

Standard Name	Reference
SEC11	*Novick P, et al.* (1980)** Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15

Date	Note
1992-10-01	Edition 11: sec11 has been physically mapped and is proximal and adjacent to dal81 *Mortimer RK, et al.* (1992)** Genetic and physical maps of Saccharomyces cerevisiae, Edition 11. Yeast 8(10):817-902

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YIR022W SGD Systematic Sequence

854840 NCBI: Gene ID

NP_012288.1 NCBI: RefSeq protein version ID

NP_012288.1 NCBI: RefSeq protein version ID

6322213 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YIR022W	SGD Systematic Sequence
854840	NCBI: Gene ID
NP_012288.1	NCBI: RefSeq protein version ID
NP_012288.1	NCBI: RefSeq protein version ID
6322213	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
30 curated references; 0 references not yet curated
Mutants/Phenotypes
Strains/Constructs
Perry RJ, et al. (2009) Endoplasmic Reticulum-Associated Secretory Proteins Sec20p, Sec39p, and Dsl1p Are Involved in Peroxisome Biogenesis. Eukaryot Cell 8(6):830-843
       |BOS1 |COP1 |DSL1 |PEX3 |POT1 |SEC1 |SEC12 |SEC13 |SEC14 |SEC17 |SEC18 |SEC20 |SEC21 |SEC26 |MORE
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Protein Processing/Modification/Regulation
Techniques and Reagents
Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48
         |AAC1 |AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |MORE
Reviews
Weerapana E and Imperiali B (2006) Asparagine-linked protein glycosylation: from eukaryotic to prokaryotic systems. Glycobiology 16(6):91R-101R
       |ALG1 |ALG11 |ALG13 |ALG14 |ALG2 |ALG7 |ALG9 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |RFT1 |MORE
Non-Fungal Related Genes/Proteins
Bardy SL, et al. (2005) Site-directed mutagenesis analysis of amino acids critical for activity of the type I signal peptidase of the archaeon Methanococcus voltae. J Bacteriol 187(3):1188-91

Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52
           |ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
Cross-species Expression
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
De La Rosa JM, et al. (2004) Characterization of Candida albicans orthologue of the Saccharomyces cerevisiae signal-peptidase-subunit encoding gene SPC3. Yeast 21(10):883-94
       |SEC61 |SPC3
Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Chen X, et al. (2001) Signal peptidase and oligosaccharyltransferase interact in a sequential and dependent manner within the endoplasmic reticulum. J Biol Chem 276(4):2411-6

Function/Process
Mutants/Phenotypes
Strains/Constructs
Grant AM, et al. (2001) NBD-labeled phosphatidylcholine and phosphatidylethanolamine are internalized by transbilayer transport across the yeast plasma membrane. Traffic 2(1):37-50
       |SEC1 |SEC12 |SEC14 |SEC18 |SEC21 |SEC22 |SEC6 |SLA2
Cellular Location
Function/Process
Protein-protein Interactions
Regulation of
Antonin W, et al. (2000) Interactions between Spc2p and other components of the endoplasmic reticulum translocation sites of the yeast Saccharomyces cerevisiae. J Biol Chem 275(44):34068-72
       |SBH1 |SBH2 |SEC61 |SPC1 |SPC2 |SPC3 |SSH1 |SSS1
Function/Process
Protein Sequence Features
Protein/Nucleic Acid Structure
VanValkenburgh C, et al. (1999) The catalytic mechanism of endoplasmic reticulum signal peptidase appears to be distinct from most eubacterial signal peptidases. J Biol Chem 274(17):11519-25
       |SPC3
Fungal Related Genes/Proteins
Fang H, et al. (1997) In addition to SEC11, a newly identified gene, SPC3, is essential for signal peptidase activity in the yeast endoplasmic reticulum. J Biol Chem 272(20):13152-8
       |SPC2 |SPC3
Fungal Related Genes/Proteins
Protein-protein Interactions
Meyer HA and Hartmann E (1997) The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. J Biol Chem 272(20):13159-64
       |SPC2 |SPC3
Mutants/Phenotypes
Regulatory Role
Craven RA, et al. (1996) A novel Hsp70 of the yeast ER lumen is required for the efficient translocation of a number of protein precursors. EMBO J 15(11):2640-50
     |IRE1 |KAR2 |LHS1 |SEC53 |SEC59
Genetic Interactions
Protein-protein Interactions
Fang H, et al. (1996) The homologue of mammalian SPC12 is important for efficient signal peptidase activity in Saccharomyces cerevisiae. J Biol Chem 271(28):16460-5
       |SPC1 |SYS1
Genetic Interactions
Mullins C, et al. (1996) Structurally related Spc1p and Spc2p of yeast signal peptidase complex are functionally distinct. J Biol Chem 271(46):29094-9
       |SPC1 |SPC2
Mutants/Phenotypes
Mullins C, et al. (1995) A mutation affecting signal peptidase inhibits degradation of an abnormal membrane protein in Saccharomyces cerevisiae. J Biol Chem 270(29):17139-47
       |KAR2
Mutants/Phenotypes
Mizuta K and Warner JR (1994) Continued functioning of the secretory pathway is essential for ribosome synthesis. Mol Cell Biol 14(4):2493-502
     |PRC1 |SEC1 |SEC14 |SEC18 |SEC53 |SEC63 |SEC7 |SLY1
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Kean LS, et al. (1993) Retrograde lipid traffic in yeast: identification of two distinct pathways for internalization of fluorescent-labeled phosphatidylcholine from the plasma membrane. J Cell Biol 123(6 Pt 1):1403-19
     |CHC1 |SEC1 |SEC12 |SEC14 |SEC17 |SEC18 |SEC2 |SEC21 |SEC4 |SEC6 |SEC63 |SEC65 |SEC7
Non-Fungal Related Genes/Proteins
Shelness GS, et al. (1993) Membrane topology and biogenesis of eukaryotic signal peptidase. J Biol Chem 268(7):5201-8

Non-Fungal Related Genes/Proteins
Protein Sequence Features
van Dijl JM, et al. (1992) Signal peptidase I of Bacillus subtilis: patterns of conserved amino acids in prokaryotic and eukaryotic type I signal peptidases. EMBO J 11(8):2819-28

Mapping
Daugherty JR and Cooper TG (1991) The SEC11 gene is situated adjacent to DAL81 on the right arm of chromosome IX in Saccharomyces cerevisiae. Yeast 7(7):757-60
     |DAL81
Reviews
Jones EW (1991) Three proteolytic systems in the yeast saccharomyces cerevisiae. J Biol Chem 266(13):7963-6
       |CPS1 |DAP2 |KEX1 |KEX2 |LAP4 |PEP4 |PRB1 |PRC1 |PRE1 |STE13 |YPS1
Function/Process
Protein Physical Properties
Techniques and Reagents
YaDeau JT, et al. (1991) Yeast signal peptidase contains a glycoprotein and the Sec11 gene product. Proc Natl Acad Sci U S A 88(2):517-21

Non-Fungal Related Genes/Proteins
Shelness GS and Blobel G (1990) Two subunits of the canine signal peptidase complex are homologous to yeast SEC11 protein. J Biol Chem 265(16):9512-9

Non-Fungal Related Genes/Proteins
Greenburg G, et al. (1989) A subunit of mammalian signal peptidase is homologous to yeast SEC11 protein. J Biol Chem 264(27):15762-5

Cellular Location
Other Features
YaDeau JT and Blobel G (1989) Solubilization and characterization of yeast signal peptidase. J Biol Chem 264(5):2928-34
       |SPC1 |SPC2 |SPC3
DNA/RNA Sequence Features
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Protein Processing/Modification/Regulation
Protein Sequence Features
Strains/Constructs
Bohni PC, et al. (1988) SEC11 is required for signal peptide processing and yeast cell growth. J Cell Biol 106(4):1035-42

Function/Process
Mutants/Phenotypes
Strains/Constructs
Ramirez RM, et al. (1983) Plasma membrane expansion terminates in Saccharomyces cerevisiae secretion-defective mutants while phospholipid synthesis continues. J Bacteriol 154(3):1276-83
     |GDI1 |SEC1 |SEC10 |SEC12 |SEC13 |SEC14 |SEC15 |SEC16 |SEC17 |SEC18 |SEC2 |SEC20 |SEC21 |SEC22 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Novick P, et al. (1980) Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15
       |GDI1 |SEC1 |SEC10 |SEC12 |SEC13 |SEC14 |SEC15 |SEC16 |SEC17 |SEC18 |SEC2 |SEC20 |SEC21 |SEC22 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.