---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

AXL2/YIL140W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIX: 85366 to 87837 CDS: 85366 - 87837 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
AXL2	YIL140W	BUD10, SRO4	ORF, Verified	S000001402
Description
Integral plasma membrane protein required for axial budding in haploid cells, localizes to the incipient bud site and bud neck; glycosylated by Pmt4p; potential Cdc28p substrate

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By calcium ion binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006644 , EBI:IPR015919 Assigned on 2008-02-13 UniProtKB molecular_function unknown Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By axial cellular bud site selection Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD cell division Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular bud site selection Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-03-02 SGD cellular cell wall organization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cofactor transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT organic acid transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT regulation of signal transduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT sexual reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cellular bud neck Sundin BA, et al. (2004) Localization of proteins that are coordinately expressed with Cln2 during the cell cycle. Yeast 21(9):793-800        IDA : Inferred from Direct Assay Assigned on 2004-10-08 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9905 Assigned on 2009-10-01 UniProtKB integral to plasma membrane Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006644 , EBI:IPR015919 Assigned on 2008-02-13 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-02-14 UniProtKB plasma membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-1003 Assigned on 2009-06-29 UniProtKB septin ring Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forAXL2/YIL140W for AXL2 1) Roemer T, et al. (1996) Selection of axial growth sites in yeast requires Axl2p, a novel plasma membrane glycoprotein. Genes Dev 10(7):777-93      2) Sanders SL, et al. (1999) O-Glycosylation of Axl2/Bud10p by Pmt4p is required for its stability, localization, and function in daughter cells. J Cell Biol 145(6):1177-88        3) Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for AXL2/YIL140W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for AXL2/YIL140W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MTQLQIS C-term GRIPEML Length(aa) 823 MW(Da) 90,782 pI 4.68 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.121   Codon Adaptation Index 0.156   Frequency of Optimal Codons 0.477   Hydropathicity of Protein -0.413   Aromaticity Score 0.095

10 20 30 40 50 | | | | | MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESFTFQISN DTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLY FNVILEGTDSADSTSLNNTYQFVVTNRPSISLSSDFNLLALLKNYGYTNG KNALKLDPNEVFNVTFDRSMFTNEESIVSYYGRSQLYNAPLPNWLFFDSG ELKFTGTAPVINSAIAPETSYSFVIIATDIEGFSAVEVEFELVIGAHQLT TSIQNSLIINVTDTGNVSYDLPLNYVYLDDDPISSDKLGSINLLDAPDWV ALDNATISGSVPDELLGKNSNPANFSVSIYDTYGDVIYFNFEVVSTTDLF AISSLPNINATRGEWFSYYFLPSQFTDYVNTNVSLEFTNSSQDHDWVKFQ SSNLTLAGEVPKNFDKLSLGLKANQGSQSQELYFNIIGMDSKITHSNHSA NATSTRSSHHSTSTSSYTSSTYTAKISSTSAAATSSAPAALPAANKTSSH NKKAVAIACGVAIPLGVILVALICFLIFWRRRRENPDDENLPHAISGPDL NNPANKPNQENATPLNNPFDDDASSYDDTSIARRLAALNTLKLDNHSATE SDISSVDEKRDSLSGMNTYNDQFQSQSKEELLAKPPVQPPESPFFDPQNR SSSVYMDSEPAVNKSWRYTGNLSPVSDIVRDSYGSQKTVDTEKLFDLEAP EKEKRTSRDVTMSSLDPWNSNISPSPVRKSVTPSPYNVTKHRNRHLQNIQ DSQSGKNGITPTTMSTSSSDDFVPVKDGENFCWVHSMEPDRRPSKKRLVD FSNKSNVNVGQVKDIHGRIPEML*

Protein Structures from PDB: proteins of known structure with sequence similarity to AXL2/YIL140W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
AXL2	SGD (2007) Information without a citation in SGD

Nomenclature History Notes

Date	Note
2001-01-30	AXL2 became the standard name (and SRO4 an alias) after consensus was reached among researchers (2001-01-30).

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YIL140W	SGD Systematic Sequence
854666	NCBI: Gene ID
NP_012126.1	NCBI: RefSeq protein version ID
NP_012126.1	NCBI: RefSeq protein version ID
6322051	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
Protein Details Topic Research Highlight Reference Contributor Protein Modification Description: Identified as an efficient substrate of Clb2-Cdk1-as1 in a screen of a proteomic GST-fusion library. Modification Type: Phosphorylation Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64          Jeff Ubersax 2004-01-27

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
28 curated references; 0 references not yet curated
DNA/RNA Sequence Features Fungal Related Genes/Proteins	Gordon JL, et al. (2009) Additions, losses, and rearrangements on the evolutionary route from a reconstructed ancestor to the modern Saccharomyces cerevisiae genome. PLoS Genet 5(5):e1000485	|ABM1 |ADH1 |ADH2 |ARI1 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |AUS1 |AZR1 |CCT2 |DAL4 |DAL7 |DIA3 |MORE
RNA Levels and Processing Regulation of	Roberts GG 3rd and Hudson AP (2009) Rsf1p is required for an efficient metabolic shift from fermentative to glycerol-based respiratory growth in S. cerevisiae. Yeast 26(2):95-110	|ABC1 |ACH1 |AEP2 |AGP2 |AGX1 |AHP1 |AIM33 |AIM39 |ANB1 |ARN1 |ARN2 |ATG3 |ATP1 |ATP10 |MORE
Reviews	Slaughter BD, et al. (2009) Symmetry breaking in the life cycle of the budding yeast. Cold Spring Harbor Perspect Biol 1(3):a003384	|AXL1 |BEM1 |BNI1 |BNR1 |BUD2 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9 |CDC24 |CDC42 |FAR1 |RAX1 |MORE
Fungal Related Genes/Proteins	Banuett F, et al. (2008) The machinery for cell polarity, cell morphogenesis, and the cytoskeleton in the Basidiomycete fungus Ustilago maydis-a survey of the genome sequence. Fungal Genet Biol 45 Suppl 1:S3-S14	|ABP1 |ACT1 |ARP1 |ARP10 |ARP2 |ARP3 |BEM1 |BIK1 |BIM1 |BNI1 |BUD6 |CDC10 |CDC11 |CDC12 |MORE
Reviews	Lengeler KB, et al. (2008) Protein-O-mannosyltransferases in virulence and development. Cell Mol Life Sci 65(4):528-44	|AGA1 |AGA2 |BAR1 |CIS3 |CTS1 |FUS1 |GAS1 |HSP150 |KEX2 |KRE9 |MID2 |PIR1 |PIR3 |PMT1 |MORE
Cell Cycle Phase Involved Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Gao XD, et al. (2007) Sequential and distinct roles of the cadherin domain-containing protein Axl2p in cell polarization in yeast cell cycle. Mol Biol Cell 18(7):2542-60	|BEM1 |BUD3 |BUD4 |CDC24 |CDC42 |CLA4 |GIC2 |GIN4 |RSR1 |SWE1
Function/Process Mutants/Phenotypes Strains/Constructs	Loewen CJ, et al. (2007) Inheritance of cortical ER in yeast is required for normal septin organization. J Cell Biol 179(3):467-83	|BEM2 |BEM3 |BIM1 |BNI1 |BUD3 |BUD6 |CDC10 |CLA4 |HSL7 |ICE2 |MIH1 |MSB3 |MSB4 |MYO4 |MORE
Reviews	Park HO and Bi E (2007) Central roles of small GTPases in the development of cell polarity in yeast and beyond. Microbiol Mol Biol Rev 71(1):48-96	|ACT1 |AXL1 |BEM1 |BEM2 |BEM3 |BNI1 |BUD2 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9 |CDC10 |CDC11 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gandhi M, et al. (2006) Four novel suppressors of gic1 gic2 and their roles in cytokinesis and polarized cell growth in Saccharomyces cerevisiae. Genetics 174(2):665-78	|ACT1 |BNI1 |CDC3 |CLN2 |CYC8 |GIC1 |GIC2 |HOF1 |MLF3 |MSB1 |MSB2 |MYO1 |RSR1 |SKG6 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Fujita A, et al. (2004) Rax1, a protein required for the establishment of the bipolar budding pattern in yeast. Gene 327(2):161-9	|AXL1 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9 |RAX1
Cellular Location	Sundin BA, et al. (2004) Localization of proteins that are coordinately expressed with Cln2 during the cell cycle. Yeast 21(9):793-800	|ALG14 |ASF2 |BNI4 |CSI2 |DPB2 |HSL1 |JEM1 |KCC4 |MCD1 |MPS3 |NBP1 |POL12 |POL30 |PRI2 |MORE
Protein Processing/Modification/Regulation Regulation of	Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64	|ACE2 |ACF4 |ACM1 |ADY3 |ALY2 |ARG1 |ASE1 |ASH1 |ATG20 |BBP1 |BCK2 |BEM1 |BEM3 |BNA3 |MORE
Cellular Location Function/Process RNA Levels and Processing	Cullen PJ and Sprague GF Jr (2002) The roles of bud-site-selection proteins during haploid invasive growth in yeast. Mol Biol Cell 13(9):2990-3004	|AXL1 |BUD2 |BUD3 |BUD4 |BUD8 |SNF1
Disease Gene Related Non-Fungal Related Genes/Proteins Protein Sequence Features	Dickens NJ, et al. (2002) Cadherin-like domains in alpha-dystroglycan, alpha/epsilon-sarcoglycan and yeast and bacterial proteins. Curr Biol 12(6):R197-9
Alias Cellular Location Function/Process Protein Processing/Modification/Regulation Regulation of	Lord M, et al. (2002) Subcellular localization of Axl1, the cell type-specific regulator of polarity. Curr Biol 12(15):1347-52	|AXL1 |BUD3 |BUD4 |BUD5
Cellular Location Protein-protein Interactions Regulation of Strains/Constructs	Powers J and Barlowe C (2002) Erv14p directs a transmembrane secretory protein into COPII-coated transport vesicles. Mol Biol Cell 13(3):880-91	|ERV14
Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Kang PJ, et al. (2001) A GDP/GTP exchange factor involved in linking a spatial landmark to cell polarity. Science 292(5520):1376-8	|BUD3 |BUD5 |BUD8 |BUD9 |RSR1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Freedman T, et al. (2000) Mutational and hyperexpression-induced disruption of bipolar budding in yeast. Microbiology 146 ( Pt 11)():2833-43	|ACT1 |ATC1 |BUD3 |MYO2 |PDE2 |PFY1 |RSR1 |SMY1
Alias Cell Cycle Phase Involved Cellular Location Mutants/Phenotypes Protein Processing/Modification/Regulation Regulation of Strains/Constructs Transcription	Lord M, et al. (2000) Cell cycle programs of gene expression control morphogenetic protein localization. J Cell Biol 151(7):1501-12	|BUD3
Function/Process Mutants/Phenotypes Regulation of Strains/Constructs	Palecek SP, et al. (2000) Genetic analysis reveals that FLO11 upregulation and cell polarization independently regulate invasive growth in Saccharomyces cerevisiae. Genetics 156(3):1005-23	|ADH1 |ARO7 |AXL1 |BEM2 |BPL1 |BUD3 |BUD4 |CDC53 |CSE2 |DIA1 |DIA2 |DIA3 |DIA4 |ELM1 |MORE
Reviews	Pruyne D and Bretscher A (2000) Polarization of cell growth in yeast. J Cell Sci 113 ( Pt 4):571-85	|ABP1 |ACT1 |AIP1 |ARC15 |ARC18 |ARC19 |ARC35 |ARC40 |ARP2 |ARP3 |BEM1 |BNI1 |BNI4 |BNR1 |MORE
Protein Processing/Modification/Regulation Regulation of	Zhu H, et al. (2000) Analysis of yeast protein kinases using protein chips. Nat Genet 26(3):283-9	|AKL1 |ARK1 |ATG1 |BCK1 |BUB1 |BUD32 |CAK1 |CBK1 |CDC15 |CDC28 |CDC5 |CDC7 |CHK1 |CKA1 |MORE
Cellular Location Function/Process Protein Processing/Modification/Regulation Regulation of	Sanders SL, et al. (1999) O-Glycosylation of Axl2/Bud10p by Pmt4p is required for its stability, localization, and function in daughter cells. J Cell Biol 145(6):1177-88	|PMT4
Cellular Location	Powers J and Barlowe C (1998) Transport of axl2p depends on erv14p, an ER-vesicle protein related to the Drosophila cornichon gene product. J Cell Biol 142(5):1209-22	|ERV14 |ERV15
Reviews	Yang S, et al. (1997) A role for the actin cytoskeleton of Saccharomyces cerevisiae in bipolar bud-site selection. J Cell Biol 136(1):111-23	|ABP1 |ACT1 |AXL1 |BUD4 |BUD8 |BUD9 |MAD2 |SAC6 |SLA1 |SLA2 |SPA2 |SRV2
Alias Cell Cycle Phase Involved Cellular Location DNA/RNA Sequence Features Protein Physical Properties Protein Sequence Features Techniques and Reagents	Halme A, et al. (1996) Bud10p directs axial cell polarization in budding yeast and resembles a transmembrane receptor. Curr Biol 6(5):570-9	|BUD3 |BUD4
Alias Cellular Location DNA/RNA Sequence Features Function/Process Genetic Interactions Mutants/Phenotypes Protein Physical Properties Protein Processing/Modification/Regulation Protein Sequence Features Regulatory Role Strains/Constructs Techniques and Reagents	Roemer T, et al. (1996) Selection of axial growth sites in yeast requires Axl2p, a novel plasma membrane glycoprotein. Genes Dev 10(7):777-93	|BUD3 |CDC10 |SPA2
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Matsui Y and Toh-E A (1992) Yeast RHO3 and RHO4 ras superfamily genes are necessary for bud growth, and their defect is suppressed by a high dose of bud formation genes CDC42 and BEM1. Mol Cell Biol 12(12):5690-9	|ACT1 |BEM1 |CDC24 |CDC42 |RHO1 |RHO3 |RHO4 |SRO7 |SRO9

Return to SGD

Send a Message to the SGD Curators