---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

AYR1/YIL124W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIX: 126204 to 127097 CDS: 126204 - 127097 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
AYR1	YIL124W		ORF, Verified	S000001386
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 1999-10-25. Gene name expires on 2000-10-25.
Description
NADPH-dependent 1-acyl dihydroxyacetone phosphate reductase found in lipid particles, ER, and mitochondrial outer membrane; involved in phosphatidic acid biosynthesis; required for spore germination; capable of metabolizing steroid hormones

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By acylglycerone-phosphate reductase activity Athenstaedt K and Daum G (2000) 1-Acyldihydroxyacetone-phosphate reductase (Ayr1p) of the yeast Saccharomyces cerevisiae encoded by the open reading frame YIL124w is a major component of lipid particles. J Biol Chem 275(1):235-40        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:1.1.1.101 Assigned on 2007-05-23 UniProtKB binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR016040 Assigned on 2008-02-13 UniProtKB catalytic activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR016040 Assigned on 2008-02-13 UniProtKB oxidoreductase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002198 , EBI:IPR002347 , EBI:IPR020904 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By metabolic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002198 , EBI:IPR002347 , EBI:IPR016040 Assigned on 2007-05-23 UniProtKB oxidation reduction DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002347 Assigned on 2009-10-01 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2008-05-21 UniProtKB phosphatidic acid biosynthetic process Athenstaedt K and Daum G (2000) 1-Acyldihydroxyacetone-phosphate reductase (Ayr1p) of the yeast Saccharomyces cerevisiae encoded by the open reading frame YIL124w is a major component of lipid particles. J Biol Chem 275(1):235-40        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD vacuolar protein catabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cytoplasm Kumar A, et al. (2002) Subcellular localization of the yeast proteome. Genes Dev 16(6):707-19              IDA : Inferred from Direct Assay Assigned on 2002-05-07 SGD endoplasmic reticulum Athenstaedt K and Daum G (2000) 1-Acyldihydroxyacetone-phosphate reductase (Ayr1p) of the yeast Saccharomyces cerevisiae encoded by the open reading frame YIL124w is a major component of lipid particles. J Biol Chem 275(1):235-40        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0095 Assigned on 2008-02-13 UniProtKB lipid particle Athenstaedt K and Daum G (2000) 1-Acyldihydroxyacetone-phosphate reductase (Ayr1p) of the yeast Saccharomyces cerevisiae encoded by the open reading frame YIL124w is a major component of lipid particles. J Biol Chem 275(1):235-40        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0551 Assigned on 2008-02-14 UniProtKB mitochondrial outer membrane Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50          IDA : Inferred from Direct Assay Assigned on 2006-03-17 SGD mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12          IDA : Inferred from Direct Assay Assigned on 2004-09-28 SGD Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD monolayer-surrounded lipid storage body GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0154 Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
phosphatidic acid and phospholipid biosynthesis phosphatidic acid biosynthesis

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forAYR1/YIL124W for AYR1 1) Athenstaedt K and Daum G (2000) 1-Acyldihydroxyacetone-phosphate reductase (Ayr1p) of the yeast Saccharomyces cerevisiae encoded by the open reading frame YIL124w is a major component of lipid particles. J Biol Chem 275(1):235-40        2) Vico P, et al. (2002) Dehydroepiandrosterone (DHEA) metabolism in Saccharomyces cerevisiae expressing mammalian steroid hydroxylase CYP7B: Ayr1p and Fox2p display 17beta-hydroxysteroid dehydrogenase activity. Yeast 19(10):873-86        3) Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for AYR1/YIL124W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for AYR1/YIL124W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSELQSQ C-term KQKNKDD Length(aa) 297 MW(Da) 32,814 pI 9.92 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.142   Codon Adaptation Index 0.184   Frequency of Optimal Codons 0.486   Hydropathicity of Protein -0.161   Aromaticity Score 0.098	10 20 30 40 50 | | | | | MSELQSQPKKIAVVTGASGGIGYEVTKELARNGYLVYACARRLEPMAQLA IQFGNDSIKPYKLDISKPEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTF PALDATDAAVEQCFKVNVFGHINMCRELSEFLIKAKGTIVFTGSLAGVVS FPFGSIYSASKAAIHQYARGLHLEMKPFNVRVINAITGGVATDIADKRPL PETSIYNFPEGREAFNSRKTMAKDNKPMPADAYAKQLVKDILSTSDPVDV YRGTFANIMRFVMIFVPYWLLEKGLSKKFKLDKVNNALKSKQKNKDD*

Protein Structures from PDB: proteins of known structure with sequence similarity to AYR1/YIL124W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to AYR1 Homolog Source (per PDB) Protein Alignment: AYR1 vs. Homolog External Links P-Value %Identical %Similar Alignment 1ae1 ( Chain: A, B) Tropinone reductase-i complex with nadp PDB_Info PDB_Structure Datura stramonium Chain A = 3.0e-12 32 28 View alignment SCOP MMDB CATH Chain B = 3.0e-12 32 28 View alignment 2q45 ( Chain: A) Ensemble refinement of the protein crystal structure of putative tropinone reductase from arabidopsis thaliana gene at1g07440 PDB_Info PDB_Structure Arabidopsis thaliana 3.4e-12 32 30 View alignment SCOP MMDB CATH 1xq1 ( Chain: A) X-ray structure of putative tropinone reducatse from arabidopsis thaliana gene at1g07440 PDB_Info PDB_Structure Arabidopsis thaliana 3.4e-12 32 30 View alignment SCOP MMDB CATH 2jap ( Chain: C, D, B, A) Clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta- lactamase inhibitor clavulanic acid PDB_Info PDB_Structure Streptomyces clavuligerus Chain C = 1.8e-11 29 32 View alignment SCOP MMDB CATH Chain D = 1.8e-11 29 32 View alignment Chain B = 1.8e-11 29 32 View alignment Chain A = 1.8e-11 29 32 View alignment 2jah ( Chain: C, D, B, A) Biochemical and structural analysis of the clavulanic acid dehydeogenase (cad) from streptomyces clavuligerus PDB_Info PDB_Structure Streptomyces clavuligerus Chain C = 1.8e-11 29 32 View alignment SCOP MMDB CATH Chain D = 1.8e-11 29 32 View alignment Chain B = 1.8e-11 29 32 View alignment Chain A = 1.8e-11 29 32 View alignment 2ae2 ( Chain: B, A) Tropinone reductase-ii complexed with nadp+ and pseudotropine PDB_Info PDB_Structure Datura stramonium Chain B = 3.2e-11 31 27 View alignment SCOP MMDB CATH Chain A = 3.2e-11 31 27 View alignment 1ipf ( Chain: B, A) Tropinone reductase-ii complexed with nadph and tropinone PDB_Info PDB_Structure Datura stramonium Chain B = 3.2e-11 31 27 View alignment SCOP MMDB CATH Chain A = 3.2e-11 31 27 View alignment 1ipe ( Chain: B, A) Tropinone reductase-ii complexed with nadph PDB_Info PDB_Structure Datura stramonium Chain B = 3.2e-11 31 27 View alignment SCOP MMDB CATH Chain A = 3.2e-11 31 27 View alignment 2ae1 ( Chain: A) Tropinone reductase-ii PDB_Info PDB_Structure Datura stramonium 3.2e-11 31 27 View alignment SCOP MMDB CATH 1zem ( Chain: A, H, B, E, F, D, C, G) Crystal structure of nad+-bound xylitol dehydrogenase PDB_Info PDB_Structure Gluconobacter oxydans Chain A = 1.9e-10 31 31 View alignment SCOP MMDB CATH Chain H = 1.9e-10 31 31 View alignment Chain B = 1.9e-10 31 31 View alignment Chain E = 1.9e-10 31 31 View alignment Chain F = 1.9e-10 31 31 View alignment Chain D = 1.9e-10 31 31 View alignment Chain C = 1.9e-10 31 31 View alignment Chain G = 1.9e-10 31 31 View alignment 1xg5 ( Chain: C, B, D, A) Structure of human putative dehydrogenase mgc4172 in complex with nadp PDB_Info PDB_Structure Homo sapiens Chain C = 4.0e-10 28 33 View alignment SCOP MMDB CATH Chain B = 4.0e-10 28 33 View alignment Chain D = 4.0e-10 28 33 View alignment Chain A = 4.0e-10 28 33 View alignment 1iol ( Chain: A) Estrogenic 17-beta hydroxysteroid dehydrogenase complexed 17-beta-estradiol PDB_Info PDB_Structure Homo sapiens 4.3e-10 26 32 View alignment SCOP MMDB CATH 1xhl ( Chain: B, A) Crystal structure of putative tropinone reductase-ii from caenorhabditis elegans with cofactor and substrate PDB_Info PDB_Structure Caenorhabditis elegans Chain B = 4.4e-10 32 26 View alignment SCOP MMDB CATH Chain A = 4.4e-10 32 26 View alignment 1a27 ( Chain: A) Human 17-beta-hydroxysteroid-dehydrogenase type 1 c- terminal deletion mutant complexed with estradiol and nadp+ PDB_Info PDB_Structure Homo sapiens 5.0e-10 26 31 View alignment SCOP MMDB CATH 1fdw ( Chain: A) Human 17-beta-hydroxysteroid-dehydrogenase type 1 mutant h221q complexed with estradiol PDB_Info PDB_Structure Homo sapiens 5.0e-10 26 32 View alignment SCOP MMDB CATH 1qyw ( Chain: A) Crystal structure of human estrogenic 17beta-hydroxysteroid dehydrogenase comlex with androstanedione and nadp PDB_Info PDB_Structure Homo sapiens 5.8e-10 26 31 View alignment SCOP MMDB CATH 1qyv ( Chain: A) Crystal structure of human estrogenic 17beta-hydroxysteroid dehydrogenase complex with nadp PDB_Info PDB_Structure Homo sapiens 5.8e-10 26 31 View alignment SCOP MMDB CATH 1equ ( Chain: B, A) Type 1 17-beta hydroxysteroid dehydrogenase equilin complexed with nadp+ PDB_Info PDB_Structure Homo sapiens Chain B = 5.8e-10 26 31 View alignment SCOP MMDB CATH Chain A = 5.8e-10 26 31 View alignment 3dey ( Chain: X) Estradiol 17-beta-dehyd PDB_Info PDB_Structure Unknown 5.8e-10 26 31 View alignment SCOP MMDB CATH 1fds ( Chain: A) Human 17-beta-hydroxysteroid-dehydrogenase type 1 complexed with 17-beta-estradiol PDB_Info PDB_Structure Homo sapiens 5.8e-10 26 31 View alignment SCOP MMDB CATH 1fdt ( Chain: A) Human 17-beta-hydroxysteroid-dehydrogenase type 1 complexed with estradiol and nadp+ PDB_Info PDB_Structure Homo sapiens 5.8e-10 26 31 View alignment SCOP MMDB CATH 1i5r ( Chain: A) Type 1 17-beta hydroxysteroid dehydrogenase em1745 complex PDB_Info PDB_Structure Homo sapiens 5.8e-10 26 31 View alignment SCOP MMDB CATH 1dht ( Chain: A) Estrogenic 17-beta hydroxysteroid dehydrogenase complexed dihydrotestosterone PDB_Info PDB_Structure Homo sapiens 5.8e-10 26 31 View alignment SCOP MMDB CATH 1bhs ( Chain: A) Human estrogenic 17beta-hydroxysteroid dehydrogenase PDB_Info PDB_Structure Homo sapiens 5.8e-10 26 31 View alignment SCOP MMDB CATH 3dhe ( Chain: A) Estrogenic 17-beta hydroxysteroid dehydrogenase complexed dehydroepiandrosterone PDB_Info PDB_Structure Homo sapiens 5.8e-10 26 31 View alignment SCOP MMDB CATH 1qyx ( Chain: A) Crystal structure of human estrogenic 17beta-hydroxysteroid dehydrogenase complex with androstenedione and nadp PDB_Info PDB_Structure Homo sapiens 5.8e-10 26 31 View alignment SCOP MMDB CATH 1jtv ( Chain: A) Crystal structure of 17beta-hydroxysteroid dehydrogenase type 1 complexed with testosterone PDB_Info PDB_Structure Homo sapiens 5.8e-10 26 31 View alignment SCOP MMDB CATH 1vl8 ( Chain: B, A) Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution PDB_Info PDB_Structure Thermotoga maritima MSB8 Chain B = 6.3e-10 30 32 View alignment SCOP MMDB CATH Chain A = 6.3e-10 30 32 View alignment 1ja9 ( Chain: A) Crystal structure of 1,3,6,8-tetrahydroxynaphthalene reductase in complex with nadph and pyroquilon PDB_Info PDB_Structure Magnaporthe grisea 7.5e-10 29 33 View alignment SCOP MMDB CATH 1g0o ( Chain: C, D, A, B) Structure of trihydroxynaphthalene reductase in complex with nadph and pyroquilon PDB_Info PDB_Structure Magnaporthe grisea Chain C = 8.0e-10 31 29 View alignment SCOP MMDB CATH Chain D = 8.0e-10 31 29 View alignment Chain A = 8.0e-10 31 29 View alignment Chain B = 8.0e-10 31 29 View alignment 1doh ( Chain: B, A) Structure of trihydroxynaphthalene reductase in complex with nadph and 4-nitro-inden-1-one PDB_Info PDB_Structure Magnaporthe grisea Chain B = 8.0e-10 31 29 View alignment SCOP MMDB CATH Chain A = 8.0e-10 31 29 View alignment 1ybv ( Chain: B, A) Structure of trihydroxynaphthalene reductase in complex with nadph and an active site inhibitor PDB_Info PDB_Structure Magnaporthe grisea Chain B = 8.0e-10 31 29 View alignment SCOP MMDB CATH Chain A = 8.0e-10 31 29 View alignment 1g0n ( Chain: B, A) Structure of trihydroxynaphthalene reductase in complex with nadph and 4,5,6,7-tetrachloro-phthalide PDB_Info PDB_Structure Magnaporthe grisea Chain B = 8.0e-10 31 29 View alignment SCOP MMDB CATH Chain A = 8.0e-10 31 29 View alignment 1fdv ( Chain: B, D, A, C) Human 17-beta-hydroxysteroid-dehydrogenase type 1 mutant h221l complexed with nad+ PDB_Info PDB_Structure Homo sapiens Chain B = 8.1e-10 26 31 View alignment SCOP MMDB CATH Chain D = 8.1e-10 26 31 View alignment Chain A = 8.1e-10 26 31 View alignment Chain C = 8.1e-10 26 31 View alignment 1fdu ( Chain: B, D, C, A) Human 17-beta-hydroxysteroid-dehydrogenase type 1 mutant h221l complexed with estradiol and nadp+ PDB_Info PDB_Structure Homo sapiens Chain B = 8.1e-10 26 31 View alignment SCOP MMDB CATH Chain D = 8.1e-10 26 31 View alignment Chain C = 8.1e-10 26 31 View alignment Chain A = 8.1e-10 26 31 View alignment 2c07 ( Chain: A) Oxoacyl-acp reductase of plasmodium falciparum PDB_Info PDB_Structure Plasmodium falciparum 1.4e-09 31 29 View alignment SCOP MMDB CATH 3e9n ( Chain: D, F, E, B, H, G, C, A) Crystal structure of a putative short-chain dehydrogenase/reductase from corynebacterium glutamicum PDB_Info PDB_Structure Corynebacterium glutamicum Chain D = 2.3e-09 32 27 View alignment SCOP MMDB CATH Chain F = 2.3e-09 32 27 View alignment Chain E = 2.3e-09 32 27 View alignment Chain B = 2.3e-09 32 27 View alignment Chain H = 2.3e-09 32 27 View alignment Chain G = 2.3e-09 32 27 View alignment Chain C = 2.3e-09 32 27 View alignment Chain A = 2.3e-09 32 27 View alignment 1h5q ( Chain: B, C, G, I, D, L, E, H, F, J, A, K) Mannitol dehydrogenase from agaricus bisporus PDB_Info PDB_Structure Agaricus bisporus Chain B = 2.7e-09 31 26 View alignment SCOP MMDB CATH Chain C = 2.7e-09 31 26 View alignment Chain G = 2.7e-09 31 26 View alignment Chain I = 2.7e-09 31 26 View alignment Chain D = 2.7e-09 31 26 View alignment Chain L = 2.7e-09 31 26 View alignment Chain E = 2.7e-09 31 26 View alignment Chain H = 2.7e-09 31 26 View alignment Chain F = 2.7e-09 31 26 View alignment Chain J = 2.7e-09 31 26 View alignment Chain A = 2.7e-09 31 26 View alignment Chain K = 2.7e-09 31 26 View alignment 1bdb ( Chain: A) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase from pseudomonas sp. lb400 PDB_Info PDB_Structure Pseudomonas sp. 4.6e-09 29 30 View alignment SCOP MMDB CATH 1geg ( Chain: F, C, H, D, A, G, B, E) Cryatal structure analysis of meso-2,3-butanediol dehydrogenase PDB_Info PDB_Structure Klebsiella pneumoniae Chain F = 4.9e-09 27 29 View alignment SCOP MMDB CATH Chain C = 4.9e-09 27 29 View alignment Chain H = 4.9e-09 27 29 View alignment Chain D = 4.9e-09 27 29 View alignment Chain A = 4.9e-09 27 29 View alignment Chain G = 4.9e-09 27 29 View alignment Chain B = 4.9e-09 27 29 View alignment Chain E = 4.9e-09 27 29 View alignment 2ehd ( Chain: A, B) Crystal structure analysis of oxidoreductase PDB_Info PDB_Structure Thermus thermophilus HB8 Chain A = 8.3e-09 30 27 View alignment SCOP MMDB CATH Chain B = 8.3e-09 30 27 View alignment 3emk ( Chain: B, A, C, D) .5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis PDB_Info PDB_Structure Brucella melitensis Chain B = 9.9e-09 28 30 View alignment SCOP MMDB CATH Chain A = 9.9e-09 28 30 View alignment Chain C = 9.9e-09 28 30 View alignment Chain D = 9.9e-09 28 30 View alignment 3enn ( Chain: C, B, D, A) .1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) PDB_Info PDB_Structure Brucella melitensis Chain C = 1.1e-08 28 30 View alignment SCOP MMDB CATH Chain B = 1.1e-08 28 30 View alignment Chain D = 1.1e-08 28 30 View alignment Chain A = 1.1e-08 28 30 View alignment 1xkq ( Chain: B, A, D, C) Crystal structure of short-chain dehydrogenase/reductase of unknown function from caenorhabditis elegans with cofactor PDB_Info PDB_Structure Caenorhabditis elegans Chain B = 1.1e-08 28 34 View alignment SCOP MMDB CATH Chain A = 1.1e-08 28 34 View alignment Chain D = 1.1e-08 28 34 View alignment Chain C = 1.1e-08 28 34 View alignment 1spx ( Chain: A) Crystal structure of glucose dehydrogenase of caenorhabditis elegans in the apo-form PDB_Info PDB_Structure Caenorhabditis elegans 1.2e-08 30 29 View alignment SCOP MMDB CATH 3ctm ( Chain: C, F, G, E, D, A, B, H) Crystal structure of a carbonyl reductase from candida parapsilosis with anti-prelog stereo-specificity PDB_Info PDB_Structure Candida parapsilosis Chain C = 1.5e-08 30 30 View alignment SCOP MMDB CATH Chain F = 1.5e-08 30 30 View alignment Chain G = 1.5e-08 30 30 View alignment Chain E = 1.5e-08 30 30 View alignment Chain D = 1.5e-08 30 30 View alignment Chain A = 1.5e-08 30 30 View alignment Chain B = 1.5e-08 30 30 View alignment Chain H = 1.5e-08 30 30 View alignment 2bgk ( Chain: A, B) X-ray structure of apo-secoisolariciresinol dehydrogenase PDB_Info PDB_Structure Podophyllum peltatum Chain A = 1.9e-08 29 31 View alignment SCOP MMDB CATH Chain B = 1.9e-08 29 31 View alignment 2bgl ( Chain: A) X-ray structure of binary-secoisolariciresinol dehydrogenase PDB_Info PDB_Structure Podophyllum peltatum 1.9e-08 29 31 View alignment SCOP MMDB CATH 2bgm ( Chain: A) X-ray structure of ternary-secoisolariciresinol dehydrogenase PDB_Info PDB_Structure Podophyllum peltatum 1.9e-08 29 31 View alignment SCOP MMDB CATH 1cyd ( Chain: A, D, C, B) Carbonyl reductase complexed with nadph and 2-propanol PDB_Info PDB_Structure Mus musculus Chain A = 3.1e-08 29 32 View alignment SCOP MMDB CATH Chain D = 3.1e-08 29 32 View alignment Chain C = 3.1e-08 29 32 View alignment Chain B = 3.1e-08 29 32 View alignment 3h7a ( Chain: B, D, C, A) short chain dehydrogena PDB_Info PDB_Structure Unknown Chain B = 6.4e-08 27 35 View alignment SCOP MMDB CATH Chain D = 6.4e-08 27 35 View alignment Chain C = 6.4e-08 27 35 View alignment Chain A = 6.4e-08 27 35 View alignment 1ahi ( Chain: B, A) Alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid PDB_Info PDB_Structure Escherichia coli Chain B = 6.4e-08 27 33 View alignment SCOP MMDB CATH Chain A = 6.4e-08 27 33 View alignment 1fmc ( Chain: A, B) -alpha-hydroxysteroid dehydrogenase complex with nadh and 7-oxo glycochenodeoxycholic acid PDB_Info PDB_Structure Escherichia coli Chain A = 6.4e-08 27 33 View alignment SCOP MMDB CATH Chain B = 6.4e-08 27 33 View alignment 1ahh ( Chain: B, A) Alpha-hydroxysteroid dehydrogenase complexed with nad+ PDB_Info PDB_Structure Escherichia coli Chain B = 6.4e-08 27 33 View alignment SCOP MMDB CATH Chain A = 6.4e-08 27 33 View alignment 3gaf ( Chain: F, D, E, B, G, A, H, C) .2a crystal structure of 7-alpha-hydroxysteroid dehydrogenase from brucella melitensis PDB_Info PDB_Structure Brucella melitensis Chain F = 6.5e-08 28 29 View alignment SCOP MMDB CATH Chain D = 6.5e-08 28 29 View alignment Chain E = 6.5e-08 28 29 View alignment Chain B = 6.5e-08 28 29 View alignment Chain G = 6.5e-08 28 29 View alignment Chain A = 6.5e-08 28 29 View alignment Chain H = 6.5e-08 28 29 View alignment Chain C = 6.5e-08 28 29 View alignment 2cfc ( Chain: D, C, B, A) Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases PDB_Info PDB_Structure Xanthobacter autotrophicus Chain D = 7.4e-08 31 28 View alignment SCOP MMDB CATH Chain C = 7.4e-08 31 28 View alignment Chain B = 7.4e-08 31 28 View alignment Chain A = 7.4e-08 31 28 View alignment 3dwf ( Chain: D, C, A, B) 11-beta-hydroxysteroid PDB_Info PDB_Structure Unknown Chain D = 1.1e-07 30 26 View alignment SCOP MMDB CATH Chain C = 1.1e-07 30 26 View alignment Chain A = 1.1e-07 30 26 View alignment Chain B = 1.1e-07 30 26 View alignment 3g49 ( Chain: B, D, C, A) 11-beta-hydroxysteroid PDB_Info PDB_Structure Unknown Chain B = 1.1e-07 30 26 View alignment SCOP MMDB CATH Chain D = 1.1e-07 30 26 View alignment Chain C = 1.1e-07 30 26 View alignment Chain A = 1.1e-07 30 26 View alignment 2irw ( Chain: C, F, A, B, E, D, H, G) Human 11-beta-hydroxysteroid dehydrogenase (hsd1) with nadp and adamantane ether inhibitor PDB_Info PDB_Structure Homo sapiens Chain C = 1.2e-07 29 28 View alignment SCOP MMDB CATH Chain F = 1.2e-07 29 28 View alignment Chain A = 1.2e-07 29 28 View alignment Chain B = 1.2e-07 29 28 View alignment Chain E = 1.2e-07 29 28 View alignment Chain D = 1.2e-07 29 28 View alignment Chain H = 1.2e-07 29 28 View alignment Chain G = 1.2e-07 29 28 View alignment 1xse ( Chain: B, A) Crystal structure of guinea pig 11beta-hydroxysteroid dehydrogenase type 1 PDB_Info PDB_Structure Cavia porcellus Chain B = 1.2e-07 30 26 View alignment SCOP MMDB CATH Chain A = 1.2e-07 30 26 View alignment 2uvd ( Chain: D, B, A, H, C, E, F, G) The crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989) PDB_Info PDB_Structure Bacillus anthracis Chain D = 1.3e-07 28 34 View alignment SCOP MMDB CATH Chain B = 1.3e-07 28 34 View alignment Chain A = 1.3e-07 28 34 View alignment Chain H = 1.3e-07 28 34 View alignment Chain C = 1.3e-07 28 34 View alignment Chain E = 1.3e-07 28 34 View alignment Chain F = 1.3e-07 28 34 View alignment Chain G = 1.3e-07 28 34 View alignment 3d5q ( Chain: D, B, A, C) Crystal structure of 11b-hsd1 in complex with triazole inhibitor PDB_Info PDB_Structure Homo sapiens Chain D = 1.3e-07 29 28 View alignment SCOP MMDB CATH Chain B = 1.3e-07 29 28 View alignment Chain A = 1.3e-07 29 28 View alignment Chain C = 1.3e-07 29 28 View alignment 3byz ( Chain: D, C, A, B) -amino-1,3-thiazol-4(5h)-ones as potent and selective 11- hydroxysteroid dehydrogenase type 1 inhibitors PDB_Info PDB_Structure Homo sapiens Chain D = 1.3e-07 29 28 View alignment SCOP MMDB CATH Chain C = 1.3e-07 29 28 View alignment Chain A = 1.3e-07 29 28 View alignment Chain B = 1.3e-07 29 28 View alignment 2ilt ( Chain: A) Human 11-beta-hydroxysteroid dehydrogenase (hsd1) with nadp and adamantane sulfone inhibitor PDB_Info PDB_Structure Homo sapiens 1.3e-07 29 28 View alignment SCOP MMDB CATH 2rbe ( Chain: D, C, B, A) The discovery of 2-anilinothiazolones as 11beta-hsd1 inhibitors PDB_Info PDB_Structure Homo sapiens Chain D = 1.3e-07 29 28 View alignment SCOP MMDB CATH Chain C = 1.3e-07 29 28 View alignment Chain B = 1.3e-07 29 28 View alignment Chain A = 1.3e-07 29 28 View alignment 3ey4 ( Chain: C, B, D, A) Further studies with the 2-amino-1,3-thiazol-4(5h)-one class of 11-hydroxysteroid dehydrogenase type 1 (11-hsd1) inhibitors: reducing pregnane x receptor (pxr) activity and exploring activity in a monkey pharmacodynamic model PDB_Info PDB_Structure Homo sapiens Chain C = 1.3e-07 29 28 View alignment SCOP MMDB CATH Chain B = 1.3e-07 29 28 View alignment Chain D = 1.3e-07 29 28 View alignment Chain A = 1.3e-07 29 28 View alignment 2bel ( Chain: A, C, D, B) Structure of human 11-beta-hydroxysteroid dehydrogenase in complex with nadp and carbenoxolone PDB_Info PDB_Structure Homo sapiens Chain A = 1.3e-07 29 28 View alignment SCOP MMDB CATH Chain C = 1.3e-07 29 28 View alignment Chain D = 1.3e-07 29 28 View alignment Chain B = 1.3e-07 29 28 View alignment 3hfg ( Chain: C, D, B, A) Corticosteroid 11-beta- PDB_Info PDB_Structure Unknown Chain C = 1.4e-07 29 28 View alignment SCOP MMDB CATH Chain D = 1.4e-07 29 28 View alignment Chain B = 1.4e-07 29 28 View alignment Chain A = 1.4e-07 29 28 View alignment 1xu7 ( Chain: D, C, B, A) Crystal structure of the interface open conformation of tetrameric 11b-hsd1 PDB_Info PDB_Structure Homo sapiens Chain D = 1.4e-07 29 28 View alignment SCOP MMDB CATH Chain C = 1.4e-07 29 28 View alignment Chain B = 1.4e-07 29 28 View alignment Chain A = 1.4e-07 29 28 View alignment 3czr ( Chain: B, A) Crystal structure of human 11-beta-hydroxysteroid dehydrogenase (hsd1) in complex with arylsulfonylpiperazine inhibitor PDB_Info PDB_Structure Homo sapiens Chain B = 1.4e-07 29 28 View alignment SCOP MMDB CATH Chain A = 1.4e-07 29 28 View alignment 3ch6 ( Chain: D, A, B, E) Crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with (3,3-dimethylpiperidin-1-yl)(6-(3- fluoro-4-methylphenyl)pyridin-2-yl)methanone PDB_Info PDB_Structure Homo sapiens Chain D = 1.4e-07 29 28 View alignment SCOP MMDB CATH Chain A = 1.4e-07 29 28 View alignment Chain B = 1.4e-07 29 28 View alignment Chain E = 1.4e-07 29 28 View alignment 3bzu ( Chain: B, C, A, D) Crystal structure of human 11-beta-hydroxysteroid dehydrogenase(hsd1) in complex with nadp and thiazolone inhibitor PDB_Info PDB_Structure Homo sapiens Chain B = 1.4e-07 29 28 View alignment SCOP MMDB CATH Chain C = 1.4e-07 29 28 View alignment Chain A = 1.4e-07 29 28 View alignment Chain D = 1.4e-07 29 28 View alignment 3frj ( Chain: A, B) Corticosteroid 11-beta- PDB_Info PDB_Structure Unknown Chain A = 1.4e-07 29 28 View alignment SCOP MMDB CATH Chain B = 1.4e-07 29 28 View alignment 1xu9 ( Chain: C, B, D, A) Crystal structure of the interface closed conformation of 11b-hydroxysteroid dehydrogenase isozyme 1 PDB_Info PDB_Structure Homo sapiens Chain C = 1.4e-07 29 28 View alignment SCOP MMDB CATH Chain B = 1.4e-07 29 28 View alignment Chain D = 1.4e-07 29 28 View alignment Chain A = 1.4e-07 29 28 View alignment 3d3e ( Chain: B, C, D, A) Crystal structure of human 11-beta-hydroxysteroid dehydrogenase (hsd1) in complex with benzamide inhibitor PDB_Info PDB_Structure Homo sapiens Chain B = 1.4e-07 29 28 View alignment SCOP MMDB CATH Chain C = 1.4e-07 29 28 View alignment Chain D = 1.4e-07 29 28 View alignment Chain A = 1.4e-07 29 28 View alignment 3d4n ( Chain: B, D, C, A) Crystal structure of human 11-beta-hydroxysteroid dehydrogenase (hsd1) in complex with sulfonamide inhibitor PDB_Info PDB_Structure Homo sapiens Chain B = 1.4e-07 29 28 View alignment SCOP MMDB CATH Chain D = 1.4e-07 29 28 View alignment Chain C = 1.4e-07 29 28 View alignment Chain A = 1.4e-07 29 28 View alignment 1yxm ( Chain: B, A, D, C) Crystal structure of peroxisomal trans 2-enoyl coa reductase PDB_Info PDB_Structure Homo sapiens Chain B = 1.6e-07 26 34 View alignment SCOP MMDB CATH Chain A = 1.6e-07 26 34 View alignment Chain D = 1.6e-07 26 34 View alignment Chain C = 1.6e-07 26 34 View alignment 3ftp ( Chain: A, B, D, C) Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution PDB_Info PDB_Structure Burkholderia pseudomallei Chain A = 3.0e-07 25 32 View alignment SCOP MMDB CATH Chain B = 3.0e-07 25 32 View alignment Chain D = 3.0e-07 25 32 View alignment Chain C = 3.0e-07 25 32 View alignment 3grp ( Chain: D, C, A, B) .1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier- protein) reductase from bartonella henselae PDB_Info PDB_Structure Bartonella henselae str. Houston-1 Chain D = 3.5e-07 26 33 View alignment SCOP MMDB CATH Chain C = 3.5e-07 26 33 View alignment Chain A = 3.5e-07 26 33 View alignment Chain B = 3.5e-07 26 33 View alignment 2ph3 ( Chain: B, A) Crystal structure of 3-oxoacyl-[acyl carrier protein] reductase ttha0415 from thermus thermophilus PDB_Info PDB_Structure Thermus thermophilus HB8 Chain B = 3.6e-07 27 31 View alignment SCOP MMDB CATH Chain A = 3.6e-07 27 31 View alignment 2d1y ( Chain: A, B, D, C) Crystal structure of tt0321 from thermus thermophilus hb8 PDB_Info PDB_Structure Thermus thermophilus Chain A = 3.9e-07 25 33 View alignment SCOP MMDB CATH Chain B = 3.9e-07 25 33 View alignment Chain D = 3.9e-07 25 33 View alignment Chain C = 3.9e-07 25 33 View alignment 2zat ( Chain: C, B, D, A) Crystal structure of a mammalian reductase PDB_Info PDB_Structure Sus scrofa Chain C = 4.6e-07 25 38 View alignment SCOP MMDB CATH Chain B = 4.6e-07 25 38 View alignment Chain D = 4.6e-07 25 38 View alignment Chain A = 4.6e-07 25 38 View alignment 2rhc ( Chain: B, A) Actinorhodin ketordeuctase, actkr, with nadp+ and inhibitor emodin PDB_Info PDB_Structure Streptomyces coelicolor Chain B = 5.0e-07 26 33 View alignment SCOP MMDB CATH Chain A = 5.0e-07 26 33 View alignment 2rh4 ( Chain: A, B) Actinorhodin ketoreductase, actkr, with nadph and inhibitor emodin PDB_Info PDB_Structure Streptomyces coelicolor Chain A = 5.0e-07 26 33 View alignment SCOP MMDB CATH Chain B = 5.0e-07 26 33 View alignment 1w4z ( Chain: B, A) Structure of actinorhodin polyketide (actiii) reductase PDB_Info PDB_Structure Streptomyces coelicolor Chain B = 5.2e-07 26 33 View alignment SCOP MMDB CATH Chain A = 5.2e-07 26 33 View alignment 1rwb ( Chain: A, B, F, E) Cooperative effect of two surface amino acid mutations (q252l and e170k) of glucose dehydrogenase from bacillus megaterium iwg3 for the stabilization of oligomeric state PDB_Info PDB_Structure Bacillus megaterium Chain A = 6.6e-07 25 34 View alignment SCOP MMDB CATH Chain B = 6.6e-07 25 34 View alignment Chain F = 6.6e-07 25 34 View alignment Chain E = 6.6e-07 25 34 View alignment 2rhr ( Chain: B, A) P94l actinorhodin ketordeuctase mutant, with nadph and inhibitor emodin PDB_Info PDB_Structure Streptomyces coelicolor Chain B = 7.1e-07 26 33 View alignment SCOP MMDB CATH Chain A = 7.1e-07 26 33 View alignment 3csd ( Chain: A, B) Actinorhodin polyketide ketoreductase mutant p94l bound to nadph and the inhibitor emodin PDB_Info PDB_Structure Streptomyces coelicolor Chain A = 7.2e-07 26 33 View alignment SCOP MMDB CATH Chain B = 7.2e-07 26 33 View alignment 1g6k ( Chain: B, E, F, A) Crystal structure of glucose dehydrogenase mutant e96a complexed with nad+ PDB_Info PDB_Structure Bacillus megaterium Chain B = 7.6e-07 25 35 View alignment SCOP MMDB CATH Chain E = 7.6e-07 25 35 View alignment Chain F = 7.6e-07 25 35 View alignment Chain A = 7.6e-07 25 35 View alignment 2a4k ( Chain: A, B) -oxoacyl-[acyl carrier protein] reductase from thermus thermophilus tt0137 PDB_Info PDB_Structure Thermus thermophilus Chain A = 7.7e-07 29 26 View alignment SCOP MMDB CATH Chain B = 7.7e-07 29 26 View alignment 1i01 ( Chain: D, E, C, H, A, F, G, B) Crystal structure of beta-ketoacyl [acyl carrier protein] reductase from e. coli. PDB_Info PDB_Structure Escherichia coli Chain D = 9.7e-07 26 30 View alignment SCOP MMDB CATH Chain E = 9.7e-07 26 30 View alignment Chain C = 9.7e-07 26 30 View alignment Chain H = 9.7e-07 26 30 View alignment Chain A = 9.7e-07 26 30 View alignment Chain F = 9.7e-07 26 30 View alignment Chain G = 9.7e-07 26 30 View alignment Chain B = 9.7e-07 26 30 View alignment 1q7b ( Chain: B, A, D, C) The structure of betaketoacyl-[acp] reductase from e. coli in complex with nadp+ PDB_Info PDB_Structure Escherichia coli Chain B = 9.7e-07 26 30 View alignment SCOP MMDB CATH Chain A = 9.7e-07 26 30 View alignment Chain D = 9.7e-07 26 30 View alignment Chain C = 9.7e-07 26 30 View alignment 1gee ( Chain: A, E, B, F) Crystal structure of glucose dehydrogenase mutant q252l complexed with nad+ PDB_Info PDB_Structure Bacillus megaterium Chain A = 1.1e-06 25 34 View alignment SCOP MMDB CATH Chain E = 1.1e-06 25 34 View alignment Chain B = 1.1e-06 25 34 View alignment Chain F = 1.1e-06 25 34 View alignment 1yde ( Chain: F, L, H, A, D, G, C, B, P, N, K, I, O, J, E, M) Crystal structure of human retinal short-chain dehydrogenase/reductase 3 PDB_Info PDB_Structure Homo sapiens Chain F = 1.1e-06 25 33 View alignment SCOP MMDB CATH Chain L = 1.1e-06 25 33 View alignment Chain H = 1.1e-06 25 33 View alignment Chain A = 1.1e-06 25 33 View alignment Chain D = 1.1e-06 25 33 View alignment Chain G = 1.1e-06 25 33 View alignment Chain C = 1.1e-06 25 33 View alignment Chain B = 1.1e-06 25 33 View alignment Chain P = 1.1e-06 25 33 View alignment Chain N = 1.1e-06 25 33 View alignment Chain K = 1.1e-06 25 33 View alignment Chain I = 1.1e-06 25 33 View alignment Chain O = 1.1e-06 25 33 View alignment Chain J = 1.1e-06 25 33 View alignment Chain E = 1.1e-06 25 33 View alignment Chain M = 1.1e-06 25 33 View alignment 1gco ( Chain: A, B, F, E) Crystal structure of glucose dehydrogenase complexed with nad+ PDB_Info PDB_Structure Bacillus megaterium Chain A = 1.1e-06 25 34 View alignment SCOP MMDB CATH Chain B = 1.1e-06 25 34 View alignment Chain F = 1.1e-06 25 34 View alignment Chain E = 1.1e-06 25 34 View alignment 1x7h ( Chain: B, A) Actinorhodin polyketide ketoreductase, with nadph bound PDB_Info PDB_Structure Streptomyces coelicolor Chain B = 1.1e-06 25 34 View alignment SCOP MMDB CATH Chain A = 1.1e-06 25 34 View alignment 1xr3 ( Chain: B, A) Actinorhodin polyketide ketoreductase with nadp and the inhibitor isoniazid bound PDB_Info PDB_Structure Streptomyces coelicolor Chain B = 1.1e-06 25 34 View alignment SCOP MMDB CATH Chain A = 1.1e-06 25 34 View alignment 1x7g ( Chain: B, A) Actinorhodin polyketide ketoreductase, act kr, with nadp bound PDB_Info PDB_Structure Streptomyces coelicolor Chain B = 1.1e-06 25 34 View alignment SCOP MMDB CATH Chain A = 1.1e-06 25 34 View alignment 3gvc ( Chain: A, D, C, B) Crystal structure of probable short-chain dehydrogenase- reductase from mycobacterium tuberculosis PDB_Info PDB_Structure Mycobacterium tuberculosis Chain A = 1.2e-06 26 27 View alignment SCOP MMDB CATH Chain D = 1.2e-06 26 27 View alignment Chain C = 1.2e-06 26 27 View alignment Chain B = 1.2e-06 26 27 View alignment 3gk3 ( Chain: D, C, B, A) Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b PDB_Info PDB_Structure Burkholderia pseudomallei 1710b Chain D = 1.3e-06 25 31 View alignment SCOP MMDB CATH Chain C = 1.3e-06 25 31 View alignment Chain B = 1.3e-06 25 31 View alignment Chain A = 1.3e-06 25 31 View alignment 2p68 ( Chain: B, A) Crystal structure of aq_1716 from aquifex aeolicus vf5 PDB_Info PDB_Structure Aquifex aeolicus VF5 Chain B = 1.4e-06 28 32 View alignment SCOP MMDB CATH Chain A = 1.4e-06 28 32 View alignment 2pnf ( Chain: B, A) Structure of aquifex aeolicus fabg 3-oxoacyl-(acyl-carrier protein) reductase PDB_Info PDB_Structure Aquifex aeolicus VF5 Chain B = 1.4e-06 28 32 View alignment SCOP MMDB CATH Chain A = 1.4e-06 28 32 View alignment 1y5r ( Chain: B, A) The crystal structure of murine 11b-hydroxysteroid dehydrogenase complexed with corticosterone PDB_Info PDB_Structure Mus musculus Chain B = 1.8e-06 28 27 View alignment SCOP MMDB CATH Chain A = 1.8e-06 28 27 View alignment 1y5m ( Chain: A, B) The crystal structure of murine 11b-hydroxysteroid dehydrogenase: an important therapeutic target for diabetes PDB_Info PDB_Structure Mus musculus Chain A = 1.8e-06 28 27 View alignment SCOP MMDB CATH Chain B = 1.8e-06 28 27 View alignment 1q7c ( Chain: A, B) The structure of betaketoacyl-[acp] reductase y151f mutant in complex with nadph fragment PDB_Info PDB_Structure Escherichia coli Chain A = 1.8e-06 26 30 View alignment SCOP MMDB CATH Chain B = 1.8e-06 26 30 View alignment 2b4q ( Chain: A, B) Pseudomonas aeruginosa rhlg/nadp active-site complex PDB_Info PDB_Structure Pseudomonas aeruginosa Chain A = 2.2e-06 28 26 View alignment SCOP MMDB CATH Chain B = 2.2e-06 28 26 View alignment 1uls ( Chain: H, C, B, F, A, G, D, E) Crystal structure of tt0140 from thermus thermophilus hb8 PDB_Info PDB_Structure Thermus thermophilus Chain H = 3.5e-06 27 26 View alignment SCOP MMDB CATH Chain C = 3.5e-06 27 26 View alignment Chain B = 3.5e-06 27 26 View alignment Chain F = 3.5e-06 27 26 View alignment Chain A = 3.5e-06 27 26 View alignment Chain G = 3.5e-06 27 26 View alignment Chain D = 3.5e-06 27 26 View alignment Chain E = 3.5e-06 27 26 View alignment 3g1t ( Chain: A) Crystal structure of short chain dehydrogenase from salmonella enterica subsp. enterica serovar typhi str. ct18 PDB_Info PDB_Structure Salmonella typhi 3.8e-06 28 27 View alignment SCOP MMDB CATH 2nwq ( Chain: B, C, A, D) Short chain dehydrogenase from pseudomonas aeruginosa PDB_Info PDB_Structure Pseudomonas aeruginosa Chain B = 4.9e-06 30 29 View alignment SCOP MMDB CATH Chain C = 4.9e-06 30 29 View alignment Chain A = 4.9e-06 30 29 View alignment Chain D = 4.9e-06 30 29 View alignment 3f9i ( Chain: B, A) Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase rickettsia prowazekii PDB_Info PDB_Structure Rickettsia prowazekii Chain B = 5.1e-06 24 33 View alignment SCOP MMDB CATH Chain A = 5.1e-06 24 33 View alignment 3iah ( Chain: A, B) Short Chain Dehydrogena PDB_Info PDB_Structure Unknown Chain A = 5.2e-06 27 28 View alignment SCOP MMDB CATH Chain B = 5.2e-06 27 28 View alignment 1yb1 ( Chain: A, B) Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type xi PDB_Info PDB_Structure Homo sapiens Chain A = 5.7e-06 29 28 View alignment SCOP MMDB CATH Chain B = 5.7e-06 29 28 View alignment 1n5d ( Chain: A) Crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase PDB_Info PDB_Structure Sus scrofa 6.1e-06 33 27 View alignment SCOP MMDB CATH 1nxq ( Chain: A) Crystal structure of r-alcohol dehydrogenase (radh) (apoenyzme) from lactobacillus brevis PDB_Info PDB_Structure Lactobacillus brevis 7.1e-06 27 34 View alignment SCOP MMDB CATH 1zk4 ( Chain: A) Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and nadp PDB_Info PDB_Structure Lactobacillus brevis 7.1e-06 27 34 View alignment SCOP MMDB CATH 1zk3 ( Chain: H, A, G, E, D, B, C, F) Triclinic crystal structure of the apo-form of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis PDB_Info PDB_Structure Lactobacillus brevis Chain H = 9.8e-06 27 33 View alignment SCOP MMDB CATH Chain A = 9.8e-06 27 33 View alignment Chain G = 9.8e-06 27 33 View alignment Chain E = 9.8e-06 27 33 View alignment Chain D = 9.8e-06 27 33 View alignment Chain B = 9.8e-06 27 33 View alignment Chain C = 9.8e-06 27 33 View alignment Chain F = 9.8e-06 27 33 View alignment 1zjz ( Chain: A) Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nad PDB_Info PDB_Structure Lactobacillus brevis 9.8e-06 27 33 View alignment SCOP MMDB CATH 1zk1 ( Chain: A) Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nad PDB_Info PDB_Structure Lactobacillus brevis 9.8e-06 27 33 View alignment SCOP MMDB CATH 1zk2 ( Chain: A) Orthorhombic crystal structure of the apo-form of r- specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis PDB_Info PDB_Structure Lactobacillus brevis 9.8e-06 27 33 View alignment SCOP MMDB CATH 1zk0 ( Chain: A) Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh PDB_Info PDB_Structure Lactobacillus brevis 9.8e-06 27 33 View alignment SCOP MMDB CATH 1zjy ( Chain: A) Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh PDB_Info PDB_Structure Lactobacillus brevis 9.8e-06 27 33 View alignment SCOP MMDB CATH 1wma ( Chain: A) Crystal structure of human cbr1 in complex with hydroxy-pp PDB_Info PDB_Structure Homo sapiens 1.0e-05 35 27 View alignment SCOP MMDB CATH 3bhj ( Chain: A) Crystal structure of human carbonyl reductase 1 in complex with glutathione PDB_Info PDB_Structure Homo sapiens 1.0e-05 35 27 View alignment SCOP MMDB CATH 3bhi ( Chain: A) Crystal structure of human carbonyl reductase 1 in complex with nadp PDB_Info PDB_Structure Homo sapiens 1.0e-05 35 27 View alignment SCOP MMDB CATH 3bhm ( Chain: A) Crystal structure of human carbonyl reductase 1 in complex with s-hydroxymethylglutathione PDB_Info PDB_Structure Homo sapiens 1.0e-05 35 27 View alignment SCOP MMDB CATH 2hrb ( Chain: A) Crystal structure of human carbonyl reductase 3, complexed with nadp+ PDB_Info PDB_Structure Homo sapiens 1.0e-05 34 28 View alignment SCOP MMDB CATH 2hq1 ( Chain: A) Crystal structure of orf 1438 a putative glucose/ribitol dehydrogenase from clostridium thermocellum PDB_Info PDB_Structure Clostridium thermocellum 1.0e-05 25 32 View alignment SCOP MMDB CATH 2pfg ( Chain: A) Crystal structure of human cbr1 in complex with bigf2. PDB_Info PDB_Structure Homo sapiens 1.0e-05 35 27 View alignment SCOP MMDB CATH 2qq5 ( Chain: A) Crystal structure of human sdr family member 1 PDB_Info PDB_Structure Homo sapiens 1.4e-05 26 28 View alignment SCOP MMDB CATH 1pr9 ( Chain: B, A) Human l-xylulose reductase holoenzyme PDB_Info PDB_Structure Homo sapiens Chain B = 3.0e-05 28 30 View alignment SCOP MMDB CATH Chain A = 3.0e-05 28 30 View alignment 1wnt ( Chain: C, D, B, A) Strucutre of the tetrameric form of human l-xylulose reductase PDB_Info PDB_Structure Homo sapiens Chain C = 3.0e-05 28 30 View alignment SCOP MMDB CATH Chain D = 3.0e-05 28 30 View alignment Chain B = 3.0e-05 28 30 View alignment Chain A = 3.0e-05 28 30 View alignment 3d3w ( Chain: A, B) Structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. PDB_Info PDB_Structure Homo sapiens Chain A = 3.0e-05 28 30 View alignment SCOP MMDB CATH Chain B = 3.0e-05 28 30 View alignment 3ezl ( Chain: A) Acetoacetyl-CoA reducta PDB_Info PDB_Structure Unknown 3.0e-05 27 31 View alignment SCOP MMDB CATH 3gz4 ( Chain: B, A) Crystal structure of putative short chain dehydrogenase from escherichia coli cft073 complexed with nadph PDB_Info PDB_Structure Escherichia coli O6 Chain B = 3.1e-05 29 25 View alignment SCOP MMDB CATH Chain A = 3.1e-05 29 25 View alignment 3f5q ( Chain: A, B) Crystal structure of putative short chain dehydrogenase from escherichia coli cft073 PDB_Info PDB_Structure Escherichia coli O6 Chain A = 3.1e-05 29 25 View alignment SCOP MMDB CATH Chain B = 3.1e-05 29 25 View alignment 1uzn ( Chain: A, B) Maba from mycobacterium tuberculosis PDB_Info PDB_Structure Mycobacterium tuberculosis Chain A = 3.5e-05 26 31 View alignment SCOP MMDB CATH Chain B = 3.5e-05 26 31 View alignment 1uzm ( Chain: A, B) Maba from mycobacterium tuberculosis PDB_Info PDB_Structure Mycobacterium tuberculosis Chain A = 3.5e-05 26 31 View alignment SCOP MMDB CATH Chain B = 3.5e-05 26 31 View alignment 1k2w ( Chain: A, B) Crystal structure of sorbitol dehydrogenase from r. sphaeroides PDB_Info PDB_Structure Rhodobacter sphaeroides Chain A = 4.4e-05 28 25 View alignment SCOP MMDB CATH Chain B = 4.4e-05 28 25 View alignment 2cdh ( Chain: J, K, I, L, G, H) Architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. PDB_Info PDB_Structure Thermomyces lanuginosus Chain J = 4.8e-05 24 32 View alignment SCOP MMDB CATH Chain K = 4.8e-05 24 32 View alignment Chain I = 4.8e-05 24 32 View alignment Chain L = 4.8e-05 24 32 View alignment Chain G = 4.8e-05 24 32 View alignment Chain H = 4.8e-05 24 32 View alignment 1edo ( Chain: A) The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with nadp+ PDB_Info PDB_Structure Brassica napus 4.8e-05 24 32 View alignment SCOP MMDB CATH 3imf ( Chain: B, A, C, D) Short chain dehydrogena PDB_Info PDB_Structure Unknown Chain B = 6.0e-05 25 33 View alignment SCOP MMDB CATH Chain A = 6.0e-05 25 33 View alignment Chain C = 6.0e-05 25 33 View alignment Chain D = 6.0e-05 25 33 View alignment 2cf2 ( Chain: N, E) Architecture of mammalian fatty acid synthase PDB_Info PDB_Structure Sus scrofa Chain N = 7.0e-05 25 29 View alignment SCOP MMDB CATH Chain E = 7.0e-05 25 29 View alignment 1uzl ( Chain: B, A) Maba from mycobacterium tuberculosis PDB_Info PDB_Structure Mycobacterium tuberculosis Chain B = 9.4e-05 26 30 View alignment SCOP MMDB CATH Chain A = 9.4e-05 26 30 View alignment 3f1l ( Chain: A, B) The 0.95 a structure of an oxidoreductase, ycik from e.coli PDB_Info PDB_Structure Escherichia coli k12 Chain A = 0.000110 28 27 View alignment SCOP MMDB CATH Chain B = 0.000110 28 27 View alignment 3f1k ( Chain: A) Crystal structure of ycik from e. coli, an oxidoreductase, complexed with nadp+ at 2.6a resolution PDB_Info PDB_Structure Escherichia coli k12 0.000110 28 27 View alignment SCOP MMDB CATH 2ntn ( Chain: A, B) Crystal structure of maba-c60v/g139a/s144l PDB_Info PDB_Structure Mycobacterium tuberculosis H37Rv Chain A = 0.000139 25 32 View alignment SCOP MMDB CATH Chain B = 0.000139 25 32 View alignment 3e9q ( Chain: B, A) Crystal structure of the short chain dehydrogenase from shigella flexneri PDB_Info PDB_Structure Shigella flexneri 2a str. 301 Chain B = 0.000169 27 28 View alignment SCOP MMDB CATH Chain A = 0.000169 27 28 View alignment 2p91 ( Chain: B, A, D, C) Crystal structure of enoyl-[acyl-carrier-protein] reductase (nadh) from aquifex aeolicus vf5 PDB_Info PDB_Structure Aquifex aeolicus VF5 Chain B = 0.000179 25 35 View alignment SCOP MMDB CATH Chain A = 0.000179 25 35 View alignment Chain D = 0.000179 25 35 View alignment Chain C = 0.000179 25 35 View alignment 2nm0 ( Chain: A, B) Crystal structure of sco1815: a beta-ketoacyl-acyl carrier protein reductase from streptomyces coelicolor a3(2) PDB_Info PDB_Structure Streptomyces coelicolor A3(2) Chain A = 0.000219 22 31 View alignment SCOP MMDB CATH Chain B = 0.000219 22 31 View alignment 3f5s ( Chain: A, B) Crystal structure of putatitve short chain dehydrogenase from shigella flexneri 2a str. 301 PDB_Info PDB_Structure Shigella flexneri Chain A = 0.000259 27 28 View alignment SCOP MMDB CATH Chain B = 0.000259 27 28 View alignment 1hdc ( Chain: C, A, B, D) Mechanism of inhibition of 3alpha,20beta-hydroxysteroid dehydrogenase by a licorice-derived steroidal inhibitor PDB_Info PDB_Structure Streptomyces exfoliatus Chain C = 0.000259 24 29 View alignment SCOP MMDB CATH Chain A = 0.000259 24 29 View alignment Chain B = 0.000259 24 29 View alignment Chain D = 0.000259 24 29 View alignment 2hsd ( Chain: A, D, B, C) The refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases PDB_Info PDB_Structure Streptomyces exfoliatus Chain A = 0.000259 24 29 View alignment SCOP MMDB CATH Chain D = 0.000259 24 29 View alignment Chain B = 0.000259 24 29 View alignment Chain C = 0.000259 24 29 View alignment 3gy0 ( Chain: A) Crystal structure of putatitve short chain dehydrogenase from shigella flexneri 2a str. 301 complexed with nadp PDB_Info PDB_Structure Shigella flexneri 0.000259 27 28 View alignment SCOP MMDB CATH 2z1n ( Chain: B, A) Crystal structure of ape0912 from aeropyrum pernix k1 PDB_Info PDB_Structure Aeropyrum pernix K1 Chain B = 0.000270 25 32 View alignment SCOP MMDB CATH Chain A = 0.000270 25 32 View alignment 1z6z ( Chain: E, B, A, C, D, F) Crystal structure of human sepiapterin reductase in complex with nadp+ PDB_Info PDB_Structure Homo sapiens Chain E = 0.000299 28 28 View alignment SCOP MMDB CATH Chain B = 0.000299 28 28 View alignment Chain A = 0.000299 28 28 View alignment Chain C = 0.000299 28 28 View alignment Chain D = 0.000299 28 28 View alignment Chain F = 0.000299 28 28 View alignment 2ew8 ( Chain: A, D, C, B) Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 PDB_Info PDB_Structure Azoarcus sp. ebn1 Chain A = 0.000349 25 31 View alignment SCOP MMDB CATH Chain D = 0.000349 25 31 View alignment Chain C = 0.000349 25 31 View alignment Chain B = 0.000349 25 31 View alignment 1hxh ( Chain: C, B, A, D) Comamonas testosteroni 3beta/17beta hydroxysteroid dehydrogenase PDB_Info PDB_Structure Comamonas testosteroni Chain C = 0.000349 25 29 View alignment SCOP MMDB CATH Chain B = 0.000349 25 29 View alignment Chain A = 0.000349 25 29 View alignment Chain D = 0.000349 25 29 View alignment 2ewm ( Chain: B, A) Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 PDB_Info PDB_Structure Azoarcus Chain B = 0.000349 25 31 View alignment SCOP MMDB CATH Chain A = 0.000349 25 31 View alignment 1nfr ( Chain: B, D, C, A) Rv2002 gene product from mycobacterium tuberculosis PDB_Info PDB_Structure Mycobacterium tuberculosis Chain B = 0.000429 25 29 View alignment SCOP MMDB CATH Chain D = 0.000429 25 29 View alignment Chain C = 0.000429 25 29 View alignment Chain A = 0.000429 25 29 View alignment 1nff ( Chain: A, B) Crystal structure of rv2002 gene product from mycobacterium tuberculosis PDB_Info PDB_Structure Mycobacterium tuberculosis Chain A = 0.000429 25 29 View alignment SCOP MMDB CATH Chain B = 0.000429 25 29 View alignment 1nfq ( Chain: C, D, A, B) Rv2002 gene product from mycobacterium tuberculosis PDB_Info PDB_Structure Mycobacterium tuberculosis Chain C = 0.000429 25 29 View alignment SCOP MMDB CATH Chain D = 0.000429 25 29 View alignment Chain A = 0.000429 25 29 View alignment Chain B = 0.000429 25 29 View alignment 2bd0 ( Chain: A, D, C, B) Chlorobium tepidum sepiapterin reductase complexed with nadp and sepiapterin PDB_Info PDB_Structure Chlorobium tepidum TLS Chain A = 0.000469 24 29 View alignment SCOP MMDB CATH Chain D = 0.000469 24 29 View alignment Chain C = 0.000469 24 29 View alignment Chain B = 0.000469 24 29 View alignment 1yo6 ( Chain: D, C, A, B, F, E) Crystal structure of the putative carbonyl reductase sniffer of caenorhabditis elegans PDB_Info PDB_Structure Caenorhabditis elegans Chain D = 0.000479 25 32 View alignment SCOP MMDB CATH Chain C = 0.000479 25 32 View alignment Chain A = 0.000479 25 32 View alignment Chain B = 0.000479 25 32 View alignment Chain F = 0.000479 25 32 View alignment Chain E = 0.000479 25 32 View alignment 3cxr ( Chain: A) Crystal structure of gluconate 5-dehydrogase from streptococcus suis type 2 PDB_Info PDB_Structure Streptococcus suis 0.000499 23 35 View alignment SCOP MMDB CATH 3cxt ( Chain: A) Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 PDB_Info PDB_Structure Streptococcus suis 0.000499 23 35 View alignment SCOP MMDB CATH 2et6 ( Chain: A) (3r)-hydroxyacyl-coa dehydrogenase domain of candida tropicalis peroxisomal multifunctional enzyme type 2 PDB_Info PDB_Structure Candida tropicalis 0.000689 26 29 View alignment SCOP MMDB CATH 1iy8 ( Chain: D, E, A, B, H, C, G, F) Crystal structure of levodione reductase PDB_Info PDB_Structure Leifsonia aquatica Chain D = 0.000999 23 35 View alignment SCOP MMDB CATH Chain E = 0.000999 23 35 View alignment Chain A = 0.000999 23 35 View alignment Chain B = 0.000999 23 35 View alignment Chain H = 0.000999 23 35 View alignment Chain C = 0.000999 23 35 View alignment Chain G = 0.000999 23 35 View alignment Chain F = 0.000999 23 35 View alignment 3i3o ( Chain: C, D, A, B, F, G, H, E) Short chain dehydrogena PDB_Info PDB_Structure Unknown Chain C = 0.002501 25 30 View alignment SCOP MMDB CATH Chain D = 0.002501 25 30 View alignment Chain A = 0.002501 25 30 View alignment Chain B = 0.002501 25 30 View alignment Chain F = 0.002501 25 30 View alignment Chain G = 0.002501 25 30 View alignment Chain H = 0.002501 25 30 View alignment Chain E = 0.002501 25 30 View alignment 3ijr ( Chain: G, H, D, C, F, A, E, B) Oxidoreductase, short c PDB_Info PDB_Structure Unknown Chain G = 0.002501 25 30 View alignment SCOP MMDB CATH Chain H = 0.002501 25 30 View alignment Chain D = 0.002501 25 30 View alignment Chain C = 0.002501 25 30 View alignment Chain F = 0.002501 25 30 View alignment Chain A = 0.002501 25 30 View alignment Chain E = 0.002501 25 30 View alignment Chain B = 0.002501 25 30 View alignment 1mg5 ( Chain: A, B) Crystal structure of drosophila melanogaster alcohol dehydrogenase complexed with nadh and acetate at 1.6 a PDB_Info PDB_Structure Drosophila melanogaster Chain A = 0.003000 26 28 View alignment SCOP MMDB CATH Chain B = 0.003000 26 28 View alignment 2ekp ( Chain: A) Structure of tt0495 protein from thermus thermophilus PDB_Info PDB_Structure Thermus thermophilus HB8 0.003198 25 25 View alignment SCOP MMDB CATH 1x1e ( Chain: A) Crystal structure of tt0495 protein from thermus thermophilus hb8 PDB_Info PDB_Structure Thermus thermophilus HB8 0.003198 25 25 View alignment SCOP MMDB CATH 2ekq ( Chain: C, A, D, B) Structure of tt0495 protein from thermus thermophilus PDB_Info PDB_Structure Thermus thermophilus HB8 Chain C = 0.003198 25 25 View alignment SCOP MMDB CATH Chain A = 0.003198 25 25 View alignment Chain D = 0.003198 25 25 View alignment Chain B = 0.003198 25 25 View alignment 2fwm ( Chain: X) Crystal structure of e. coli enta, a 2,3-dihydrodihydroxy benzoate dehydrogenase PDB_Info PDB_Structure Escherichia coli 0.004001 29 26 View alignment SCOP MMDB CATH 3icc ( Chain: A, B) Putative 3-oxoacyl-(acy PDB_Info PDB_Structure Unknown Chain A = 0.004099 26 29 View alignment SCOP MMDB CATH Chain B = 0.004099 26 29 View alignment 2yw9 ( Chain: H, E, C, G, B, A, D, F) Crystal structure of tt0143 from thermus thermophilus hb8 PDB_Info PDB_Structure Thermus thermophilus HB8 Chain H = 0.004198 26 31 View alignment SCOP MMDB CATH Chain E = 0.004198 26 31 View alignment Chain C = 0.004198 26 31 View alignment Chain G = 0.004198 26 31 View alignment Chain B = 0.004198 26 31 View alignment Chain A = 0.004198 26 31 View alignment Chain D = 0.004198 26 31 View alignment Chain F = 0.004198 26 31 View alignment 1ulu ( Chain: A, C, D, B) Crystal structure of tt0143 from thermus thermophilus hb8 PDB_Info PDB_Structure Thermus thermophilus Chain A = 0.004198 26 31 View alignment SCOP MMDB CATH Chain C = 0.004198 26 31 View alignment Chain D = 0.004198 26 31 View alignment Chain B = 0.004198 26 31 View alignment 2ag5 ( Chain: A, D, C, B) Crystal structure of human dhrs6 PDB_Info PDB_Structure Homo sapiens Chain A = 0.005401 24 30 View alignment SCOP MMDB CATH Chain D = 0.005401 24 30 View alignment Chain C = 0.005401 24 30 View alignment Chain B = 0.005401 24 30 View alignment 1b2l ( Chain: A) Alcohol dehydrogenase from drosophila lebanonensis: ternary complex with nad-cyclohexanone PDB_Info PDB_Structure Scaptodrosophila lebanonensis 0.005599 25 31 View alignment SCOP MMDB CATH 1b16 ( Chain: A, B) Alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-3-pentanone PDB_Info PDB_Structure Scaptodrosophila lebanonensis Chain A = 0.005599 25 31 View alignment SCOP MMDB CATH Chain B = 0.005599 25 31 View alignment 1sby ( Chain: A, B) Alcohol dehydrogenase from drosophila lebanonensis complexed with nad+ and 2,2,2-trifluoroethanol at 1.1 a resolution PDB_Info PDB_Structure Scaptodrosophila lebanonensis Chain A = 0.005599 25 31 View alignment SCOP MMDB CATH Chain B = 0.005599 25 31 View alignment 1b14 ( Chain: B, A) Alcohol dehydrogenase from drosophila lebanonensis binary complex with nad+ PDB_Info PDB_Structure Scaptodrosophila lebanonensis Chain B = 0.005599 25 31 View alignment SCOP MMDB CATH Chain A = 0.005599 25 31 View alignment 1a4u ( Chain: A, B) Alcohol dehydrogenase from drosophila lebanonensis PDB_Info PDB_Structure Scaptodrosophila lebanonensis Chain A = 0.005599 25 31 View alignment SCOP MMDB CATH Chain B = 0.005599 25 31 View alignment 1b15 ( Chain: A, B) Alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-acetone PDB_Info PDB_Structure Scaptodrosophila lebanonensis Chain A = 0.005599 25 31 View alignment SCOP MMDB CATH Chain B = 0.005599 25 31 View alignment 1x1t ( Chain: A) Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with nad+ PDB_Info PDB_Structure Pseudomonas fragi 0.005799 25 27 View alignment SCOP MMDB CATH 1wmb ( Chain: A, B) Crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase PDB_Info PDB_Structure Pseudomonas fragi Chain A = 0.005799 25 27 View alignment SCOP MMDB CATH Chain B = 0.005799 25 27 View alignment 2ztv ( Chain: B, C, A, D) D(-)-3-hydroxybutyrate PDB_Info PDB_Structure Unknown Chain B = 0.005799 25 27 View alignment SCOP MMDB CATH Chain C = 0.005799 25 27 View alignment Chain A = 0.005799 25 27 View alignment Chain D = 0.005799 25 27 View alignment 2ztl ( Chain: D, B, A, C) D(-)-3-hydroxybutyrate PDB_Info PDB_Structure Unknown Chain D = 0.005799 25 27 View alignment SCOP MMDB CATH Chain B = 0.005799 25 27 View alignment Chain A = 0.005799 25 27 View alignment Chain C = 0.005799 25 27 View alignment 2ztm ( Chain: A, D, C, B) D(-)-3-hydroxybutyrate PDB_Info PDB_Structure Unknown Chain A = 0.005799 25 27 View alignment SCOP MMDB CATH Chain D = 0.005799 25 27 View alignment Chain C = 0.005799 25 27 View alignment Chain B = 0.005799 25 27 View alignment 2ztu ( Chain: D, B, A, C) D(-)-3-hydroxybutyrate PDB_Info PDB_Structure Unknown Chain D = 0.006798 25 27 View alignment SCOP MMDB CATH Chain B = 0.006798 25 27 View alignment Chain A = 0.006798 25 27 View alignment Chain C = 0.006798 25 27 View alignment 2gdz ( Chain: A) Crystal structure of 15-hydroxyprostaglandin dehydrogenase type1, complexed with nad+ PDB_Info PDB_Structure Homo sapiens 0.007097 23 28 View alignment SCOP MMDB CATH 3i1j ( Chain: A, B) Oxidoreductase, short c PDB_Info PDB_Structure Unknown Chain A = 0.008800 25 29 View alignment SCOP MMDB CATH Chain B = 0.008800 25 29 View alignment 1e3w ( Chain: A) Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and 3-keto butyrate PDB_Info PDB_Structure Rattus norvegicus 0.009504 24 32 View alignment SCOP MMDB CATH