PRM5/YIL117C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIX: 141566 to 140610
CDS: 141566 - 140610

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

PRM5 YIL117C ORF, Verified S000001379

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2000-09-05. Gene name expires on 2001-09-05.
Description
Pheromone-regulated protein, predicted to have 1 transmembrane segment; induced during cell integrity signaling

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2001-01-19 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
biological_process
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2009-08-24 SGD
cellular cell wall organization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
cellular response to heat Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439
       RCA : Reviewed Computational Analysis
Assigned on 2009-03-03 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
integral to membrane Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9904
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forPRM5/YIL117C for PRM5
1) Jung US and Levin DE (1999) Genome-wide analysis of gene expression regulated by the yeast cell wall integrity signalling pathway. Mol Microbiol 34(5):1049-57

2) Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PRM5/YIL117C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PRM5/YIL117C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MTVITIA

C-term EGKEQDE

Length(aa) 318

MW(Da) 34,650

pI 7.19

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.013

Codon Adaptation Index 0.109

Frequency of Optimal Codons 0.406

Hydropathicity of Protein -0.435

Aromaticity Score 0.063

10 20 30 40 50 | | | | | MTVITIAKRGLPKLTTSTSSTTTASSSSTITSVASSSSSLPLLSNSTSSS IIPSITPPSRNGNPYILDSGDMPNGTVFIVVGGIAGVIFLAILLWWVITT YSSHRLTRSVQDYESKMFSTQHTQFYGDSPYMDYPAKENFQDQVHISESD ISPGNKDESVKDALVSHTNNEKPFLSNFERPLFSLASESNRNSLFISPTG DILYKTRLSKLYQESPRLLQKPVIMTSDNVSTNSLVSTISSSSASSLDNG NEKEVGEDIRKPAKIASSPSRKLLNSPESDGSVNRNHSKGNLLVVQSKRK PTPSTYLEHMLEGKEQDE*

Protein Structures from PDB: proteins of known structure with sequence similarity to PRM5/YIL117C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
PRM5 2000-10-30 Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Standard Name	Date Standardized	Reference
PRM5	2000-10-30	Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YIL117C SGD Systematic Sequence

854689 NCBI: Gene ID

NP_012149.1 NCBI: RefSeq protein version ID

NP_012149.1 NCBI: RefSeq protein version ID

6322074 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YIL117C	SGD Systematic Sequence
854689	NCBI: Gene ID
NP_012149.1	NCBI: RefSeq protein version ID
NP_012149.1	NCBI: RefSeq protein version ID
6322074	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
DNA & RNA Details
Topic Research Highlight Reference Contributor
Other DNA & RNA Details Description: Specifically higher expression in carbon limited chemostat cultures versus carbon excess.
otherTopic: expression
Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74
Viktor Boer
2003-07-25

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
21 curated references; 0 references not yet curated
RNA Levels and Processing
Regulation of
Garcia R, et al. (2009) The High Osmotic Response and Cell Wall Integrity Pathways Cooperate to Regulate Transcriptional Responses to Zymolyase-induced Cell Wall Stress in Saccharomyces cerevisiae. J Biol Chem 284(16):10901-11
       |AFR1 |ALD3 |ALD4 |ARI1 |BCK1 |BGL2 |CCW14 |CIS3 |CRG1 |CRH1 |CTT1 |CWP1 |CWP2 |DCS2 |MORE
Regulation of
Transcription
Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461
       |AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
RNA Levels and Processing
Regulation of
Roberts GG 3rd and Hudson AP (2009) Rsf1p is required for an efficient metabolic shift from fermentative to glycerol-based respiratory growth in S. cerevisiae. Yeast 26(2):95-110
           |ABC1 |ACH1 |AEP2 |AGP2 |AGX1 |AHP1 |AIM33 |AIM39 |ANB1 |ARN1 |ARN2 |ATG3 |ATP1 |ATP10 |MORE
RNA Levels and Processing
Woo DK, et al. (2009) Multiple pathways of mitochondrial-nuclear communication in yeast: Intergenomic signaling involves ABF1 and affects a different set of genes than retrograde regulation. Biochim Biophys Acta 1789(2):135-45
       |ABF1 |ACH1 |AGX1 |ALD3 |ARG4 |ARG7 |ARO4 |ATO2 |ATO3 |ATP14 |ATP16 |ATP17 |ATP19 |ATP2 |MORE
Regulation of
Transcription
Zhang N, et al. (2009) Gis1 is required for transcriptional reprogramming of carbon metabolism and the stress response during transition into stationary phase in yeast. Microbiology 155(Pt 5):1690-8
       |AGX1 |ATG8 |BOP3 |CTT1 |DAL3 |DAL5 |DDR48 |ERG28 |FAA2 |FBP1 |FET4 |FMP16 |FRE3 |GDH3 |MORE
Protein Processing/Modification/Regulation
Regulation of
Cohen TJ, et al. (2008) Hos2p/Set3p deacetylase complex signals secretory stress through the Mpk1p cell integrity pathway. Eukaryot Cell 7(7):1191-9
       |BCK1 |CPR1 |HAC1 |HDA1 |HOS2 |HOS4 |RLM1 |RPD3 |SET3 |SIF2 |SLT2 |SNT1 |SSN8
Mutants/Phenotypes
Huang B, et al. (2008) A genome-wide screen identifies genes required for formation of the wobble nucleoside 5-methoxycarbonylmethyl-2-thiouridine in Saccharomyces cerevisiae. RNA 14(10):2183-94
       |ADO1 |ARX1 |ATS1 |BUD19 |BUD21 |BUD28 |CFD1 |CHS3 |CHS7 |CIA1 |CKA2 |CST6 |CUP5 |DBP3 |MORE
RNA Levels and Processing
Regulation of
Nunez LR, et al. (2008) Cell wall integrity MAPK pathway is essential for lipid homeostasis. J Biol Chem 283(49):34204-17
       |BCK1 |BGL2 |CCW14 |CHO2 |CHS6 |CHS7 |CKI1 |CRH1 |FLC2 |GFA1 |GIC2 |HSP150 |IME2 |INO1 |MORE
Regulation of
Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439
       |ADD37 |AFR1 |AGX1 |AHA1 |AIM17 |ALD4 |ALG13 |ARA1 |ASI1 |ATG12 |ATG8 |BAG7 |BDH1 |CAD1 |MORE
Protein Physical Properties
de Godoy LM, et al. (2008) Comprehensive mass-spectrometry-based proteome quantification of haploid versus diploid yeast. Nature 455(7217):1251-4
       |ACT1 |AFR1 |ASG7 |AXL1 |BAR1 |BEM1 |BNI1 |CDC24 |CDC28 |CDC42 |CLN1 |CLN2 |CLN3 |CTS1 |MORE
Regulation of
Transcription
Kramer RW, et al. (2007) Yeast functional genomic screens lead to identification of a role for a bacterial effector in innate immunity regulation. PLoS Pathog 3(2):e21
             |AFR1 |BMH1 |BNI1 |BNI4 |BRO1 |BUD22 |CCW12 |CDC10 |CDC26 |CNM67 |CWP1 |DAD3 |ECM33 |FIT2 |MORE
DNA/RNA Sequence Features
RNA Levels and Processing
Regulation of
Wang D, et al. (2007) Expression evolution in yeast genes of single-input modules is mainly due to changes in trans-acting factors. Genome Res 17(8):1161-9
       |ADH6 |AFG1 |APP1 |ARG8 |BNA2 |CAR2 |CHO2 |CRP1 |DIS3 |DYN1 |EMP24 |ERS1 |GPM1 |HEM1 |MORE
DNA/RNA Sequence Features
Regulation of
Chou S, et al. (2006) Regulation of mating and filamentation genes by two distinct Ste12 complexes in Saccharomyces cerevisiae. Mol Cell Biol 26(13):4794-805
       |AFR1 |AGA1 |ASG7 |BAR1 |CHS7 |CIK1 |CLN1 |CWP1 |DDR48 |DIG1 |DIG2 |FIG1 |FUS1 |FUS2 |MORE
RNA Levels and Processing
Guo Y, et al. (2006) Analysis of cellular responses to aflatoxin B(1) in yeast expressing human cytochrome P450 1A2 using cDNA microarrays. Mutat Res 593(1-2):121-42
           |AAT1 |AHA1 |ALD2 |ALD3 |ALK1 |APC1 |APC5 |APT2 |AQR1 |AQY2 |ARC40 |ARN1 |ARO10 |ARO9 |MORE
RNA Levels and Processing
Iwahashi H, et al. (2005) Adaptation of Saccharomyces cerevisiae to high hydrostatic pressure causing growth inhibition. FEBS Lett 579(13):2847-52
           |AFR1 |CRG1 |GPG1 |HSP12 |INO1 |MET13 |MET6 |MOH1 |OPI3 |PIR3 |POX1 |PST1 |PTP2 |RTA1 |MORE
Regulation of
Boorsma A, et al. (2004) Characterization of the transcriptional response to cell wall stress in Saccharomyces cerevisiae. Yeast 21(5):413-27
           |AFR1 |ASH1 |BGL2 |CCW14 |CIS3 |CRG1 |CRH1 |CRZ1 |CWP1 |CWP2 |DDR2 |DDR48 |ECM4 |FBP26 |MORE
Regulation of
Transcription
Rubin-Bejerano I, et al. (2003) Phagocytosis by neutrophils induces an amino acid deprivation response in Saccharomyces cerevisiae and Candida albicans. Proc Natl Acad Sci U S A 100(19):11007-12
             |ADE1 |ADE12 |ADE13 |ADE16 |ADE17 |ADE2 |ADE3 |ADE4 |ADE5,7 |ADE6 |ADE8 |AKR2 |ALD5 |ARG1 |MORE
Mutants/Phenotypes
Willingham S, et al. (2003) Yeast genes that enhance the toxicity of a mutant huntingtin fragment or alpha-synuclein. Science 302(5651):1769-72
           |ABZ2 |AIM46 |ALB1 |APE2 |APJ1 |APM2 |ARL3 |ARO1 |ATG15 |AYR1 |CIT2 |CMK1 |COG6 |COS111 |MORE
Regulation of
Transcription
Jung US, et al. (2002) Regulation of the yeast Rlm1 transcription factor by the Mpk1 cell wall integrity MAP kinase. Mol Microbiol 46(3):781-9
           |RLM1 |SLT2 |YKL161C
Function/Process
Protein Sequence Features
Regulation of
Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       |AGA1 |PRM1 |PRM10 |PRM2 |PRM3 |PRM4 |PRM6 |PRM7 |PRM8 |PRM9
DNA/RNA Sequence Features
RNA Levels and Processing
Regulation of
Transcription
Jung US and Levin DE (1999) Genome-wide analysis of gene expression regulated by the yeast cell wall integrity signalling pathway. Mol Microbiol 34(5):1049-57
       |BGL2 |CCW14 |CHS3 |CIS3 |CRH1 |CTT1 |CWP1 |DFG5 |FIT2 |FKS1 |GSC2 |HSP150 |IBI2 |MKK1 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.