---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP159/YIL115C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIX: 148706 to 144324 CDS: 148706 - 144324 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP159	YIL115C	NUP158, RAT7	ORF, Verified	S000001377
Description
Nucleoporin, subunit of the nuclear pore complex that is found exclusively on the cytoplasmic side, member of the Nup82 subcomplex, required for mRNA export

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural molecule activity Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75        TAS : Traceable Author Statement Assigned on 2002-03-13 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Del Priore V, et al. (1997) A structure/function analysis of Rat7p/Nup159p, an essential nucleoporin of Saccharomyces cerevisiae. J Cell Sci 110 ( Pt 23):2987-99        IMP : Inferred from Mutant Phenotype Assigned on 2002-03-13 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB nuclear pore organization Del Priore V, et al. (1997) A structure/function analysis of Rat7p/Nup159p, an essential nucleoporin of Saccharomyces cerevisiae. J Cell Sci 110 ( Pt 23):2987-99        IMP : Inferred from Mutant Phenotype Assigned on 2002-03-13 SGD nuclear transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT nucleocytoplasmic transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Gleizes PE, et al. (2001) Ultrastructural localization of rRNA shows defective nuclear export of preribosomes in mutants of the Nup82p complex. J Cell Biol 155(6):923-36        IMP : Inferred from Mutant Phenotype Assigned on 2002-03-13 SGD ribosomal subunit export from nucleus Gleizes PE, et al. (2001) Ultrastructural localization of rRNA shows defective nuclear export of preribosomes in mutants of the Nup82p complex. J Cell Biol 155(6):923-36        IMP : Inferred from Mutant Phenotype Assigned on 2002-03-13 SGD Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Nup82 complex Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51        IDA : Inferred from Direct Assay Assigned on 2009-10-14 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75        TAS : Traceable Author Statement Assigned on 2002-03-13 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP159/YIL115C for NUP159 NUP159 encodes an essential nuclear pore protein (1, 2, 3). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 3, 4, 5, 6). The structure of the vertebrate NPC has been studied extensively; recent reviews include 7, 8, 9, and 10. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (11, 12). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 3, 4, 13, 14, 15). Nup159p is one of a group of nucleoporins that contain multiple repeats of the amino acids GLFG (1, 2, 3), and is found only on the cytoplasmic face of the pore (2). At the restrictive temperature, a temperature-sensitive nup159 allele changes the distribution of NPCs within the nuclear envelope, and is defective in mRNA export from the nucleus (1). The phenotype can be partially suppressed by overexpression of the RNA export factor Gle1p (16, 3). Domain analysis suggests that the N-terminal thrid of Nup159p is important for its role in nuclear mRNA export (17). While nup159 mutants do not show protein import defects (3), Nup159p associates physically with Pse1p, a member of a protein family implicated in nuclear protein import (18). nup159 mutations are synthetically lethal with mutations in several other nucleoporin genes (3). Last Updated: 1999-08-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP159/YIL115C for NUP159 1) Gorsch LC, et al. (1995) A conditional allele of the novel repeat-containing yeast nucleoporin RAT7/NUP159 causes both rapid cessation of mRNA export and reversible clustering of nuclear pore complexes. J Cell Biol 129(4):939-55      2) Kraemer DM, et al. (1995) The essential yeast nucleoporin NUP159 is located on the cytoplasmic side of the nuclear pore complex and serves in karyopherin-mediated binding of transport substrate. J Biol Chem 270(32):19017-21        3) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      4) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    5) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      6) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      7) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      8) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      9) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      10) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      11) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      12) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        13) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      14) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        15) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      16) Del Priore V, et al. (1996) The product of the Saccharomyces cerevisiae RSS1 gene, identified as a high-copy suppressor of the rat7-1 temperature-sensitive allele of the RAT7/NUP159 nucleoporin, is required for efficient mRNA export. Mol Biol Cell 7(10):1601-21      17) Del Priore V, et al. (1997) A structure/function analysis of Rat7p/Nup159p, an essential nucleoporin of Saccharomyces cerevisiae. J Cell Sci 110 ( Pt 23):2987-99        18) Seedorf M, et al. (1999) Interactions between a nuclear transporter and a subset of nuclear pore complex proteins depend on Ran GTPase. Mol Cell Biol 19(2):1547-57        19) Hodge CA, et al. (1999) Rat8p/Dbp5p is a shuttling transport factor that interacts with Rat7p/Nup159p and Gle1p and suppresses the mRNA export defect of xpo1-1 cells. EMBO J 18(20):5778-88        20) Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51        21) Bailer SM, et al. (2000) Nup116p associates with the Nup82p-Nsp1p-Nup159p nucleoporin complex. J Biol Chem 275(31):23540-8        22) Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP159/YIL115C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP159/YIL115C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSSLKDE C-term KNLNMAK Length(aa) 1,460 MW(Da) 158,906 pI 4.56 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.052   Codon Adaptation Index 0.143   Frequency of Optimal Codons 0.442   Hydropathicity of Protein -0.595   Aromaticity Score 0.076

10 20 30 40 50 | | | | | MSSLKDEVPTETSEDFGFKFLGQKQILPSFNEKLPFASLQNLDISNSKSL FVAASGSKAVVGELQLLRDHITSDSTPLTFKWEKEIPDVIFVCFHGDQVL VSTRNALYSLDLEELSEFRTVTSFEKPVFQLKNVNNTLVILNSVNDLSAL DLRTKSTKQLAQNVTSFDVTNSQLAVLLKDRSFQSFAWRNGEMEKQFEFS LPSELEELPVEEYSPLSVTILSPQDFLAVFGNVISETDDEVSYDQKMYII KHIDGSASFQETFDITPPFGQIVRFPYMYKVTLSGLIEPDANVNVLASSC SSEVSIWDSKQVIEPSQDSERAVLPISEETDKDTNPIGVAVDVVTSGTIL EPCSGVDTIERLPLVYILNNEGSLQIVGLFHVAAIKSGHYSINLESLEHE KSLSPTSEKIPIAGQEQEEKKKNNESSKALSENPFTSANTSGFTFLKTQP AAANSLQSQSSSTFGAPSFGSSAFKIDLPSVSSTSTGVASSEQDATDPAS AKPVFGKPAFGAIAKEPSTSEYAFGKPSFGAPSFGSGKSSVESPASGSAF GKPSFGTPSFGSGNSSVEPPASGSAFGKPSFGTPSFGSGNSSAEPPASGS AFGKPSFGTSAFGTASSNETNSGSIFGKAAFGSSSFAPANNELFGSNFTI SKPTVDSPKEVDSTSPFPSSGDQSEDESKSDVDSSSTPFGTKPNTSTKPK TNAFDFGSSSFGSGFSKALESVGSDTTFKFGTQASPFSSQLGNKSPFSSF TKDDTENGSLSKGSTSEINDDNEEHESNGPNVSGNDLTDSTVEQTSSTRL PETPSDEDGEVVEEEAQKSPIGKLTETIKKSANIDMAGLKNPVFGNHVKA KSESPFSAFATNITKPSSTTPAFSFGNSTMNKSNTSTVSPMEEADTKETS EKGPITLKSVENPFLPAKEERTGESSKKDHNDDPKDGYVSGSEISVRTSE SAFDTTANEEIPKSQDVNNHEKSETDPKYSQHAVVDHDNKSKEMNETSKN NERSGQPNHGVQGDGIALKKDNEKENFDSNMAIKQFEDHQSSEEDASEKD SRQSSEVKESDDNMSLNSDRDESISESYDKLEDINTDELPHGGEAFKARE VSASADFDVQTSLEDNYAESGIQTDLSESSKENEVQTDAIPVKHNSTQTV KKEAVDNGLQTEPVETCNFSVQTFEGDENYLAEQCKPKQLKEYYTSAKVS NIPFVSQNSTLRLIESTFQTVEAEFTVLMENIRNMDTFFTDQSSIPLVKR TVRSINNLYTWRIPEAEILLNIQNNIKCEQMQITNANIQDLKEKVTDYVR KDIAQITEDVANAKEEYLFLMHFDDASSGYVKDLSTHQFRMQKTLRQKLF DVSAKINHTEELLNILKLFTVKNKRLDDNPLVAKLAKESLARDGLLKEIK LLREQVSRLQLEEKGKKASSFDASSSITKDMKGFKVVEVGLAMNTKKQIG DFFKNLNMAK*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP159/YIL115C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to NUP159 Homolog Source (per PDB) Protein Alignment: NUP159 vs. Homolog External Links P-Value %Identical %Similar Alignment 1xip ( Chain: A) Crystal structure of the n-terminal domain of nup159 PDB_Info PDB_Structure Saccharomyces cerevisiae 7.8e-148 100 0 View alignment SCOP MMDB CATH 3fmp ( Chain: C, A) Nuclear pore complex pr PDB_Info PDB_Structure Unknown Chain C = 0.006402 24 26 View alignment SCOP MMDB CATH Chain A = 0.006402 24 26 View alignment 3fmo ( Chain: A) Nuclear pore complex pr PDB_Info PDB_Structure Unknown 0.006402 24 26 View alignment SCOP MMDB CATH 3ghg ( Chain: J, A, G, D) Fibrinogen alpha chain PDB_Info PDB_Structure Unknown Chain J = 0.007696 26 24 View alignment SCOP MMDB CATH Chain A = 0.007696 26 24 View alignment Chain G = 0.007696 26 24 View alignment Chain D = 0.007696 26 24 View alignment 3hoy ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 2nvz ( Chain: A) Rna polymerase ii elongation complex with utp, updated 11/2006 PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2ja6 ( Chain: A) Cpd lesion containing rna polymerase ii elongation complex b PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3gtm ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 3how ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 2ja7 ( Chain: A, M) Cpd lesion containing rna polymerase ii elongation complex c PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 0.009195 22 33 View alignment SCOP MMDB CATH Chain M = 0.009195 22 33 View alignment 2ja5 ( Chain: A) Cpd lesion containing rna polymerase ii elongation complex a PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3hoz ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 2nvx ( Chain: A) Rna polymerase ii elongation complex in 5 mm mg+2 with 2'- dutp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3gtk ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 3hov ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 2nvy ( Chain: A) Rna polymerase ii form ii in 150 mm mn+2 PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1i3q ( Chain: A) Rna polymerase ii crystal form i at 3.1 a resolution PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2vum ( Chain: A) Alpha-amanitin inhibited complete rna polymerase ii elongation complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1nik ( Chain: A) Wild type rna polymerase ii PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2nvt ( Chain: A) Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3gtl ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 1twg ( Chain: A) Rna polymerase ii complexed with ctp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3i4n ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 2nvq ( Chain: A) Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1twa ( Chain: A) Rna polymerase ii complexed with atp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1y1y ( Chain: A) Rna polymerase ii-tfiis-dna/rna complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3gtp ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 3gto ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 1r9s ( Chain: A) Rna polymerase ii strand separated elongation complex, matched nucleotide PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1twc ( Chain: A) Rna polymerase ii complexed with gtp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3cqz ( Chain: A) Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1r9t ( Chain: A) Rna polymerase ii strand separated elongation complex, mismatched nucleotide PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1twf ( Chain: A) Rna polymerase ii complexed with utp at 2.3 a resolution PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3gtq ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 1y77 ( Chain: A) Complete rna polymerase ii elongation complex with substrate analogue gmpcpp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1r5u ( Chain: A) Rna polymerase ii tfiib complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1wcm ( Chain: A) Complete 12-subunit rna polymerase ii at 3.8 ang PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3fki ( Chain: A) -subunit rna polymerase ii refined with zn-sad data PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2e2h ( Chain: A) Rna polymerase ii elongation complex at 5 mm mg2+ with gtp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2e2j ( Chain: A) Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2ja8 ( Chain: A) Cpd lesion containing rna polymerase ii elongation complex d PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1k83 ( Chain: A) Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2r7z ( Chain: A) Cisplatin lesion containing rna polymerase ii elongation complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1i50 ( Chain: A) Rna polymerase ii crystal form ii at 2.8 a resolution PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3hou ( Chain: A, M) DNA-directed RNA polym PDB_Info PDB_Structure Unknown Chain A = 0.009195 22 33 View alignment SCOP MMDB CATH Chain M = 0.009195 22 33 View alignment 1twh ( Chain: A) Rna polymerase ii complexed with 2'datp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2yu9 ( Chain: A) Rna polymerase ii elongation complex in 150 mm mg+2 with utp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2r93 ( Chain: A) Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2b63 ( Chain: A) Complete rna polymerase ii-rna inhibitor complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1nt9 ( Chain: A) Complete 12-subunit rna polymerase ii PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1pqv ( Chain: A) Rna polymerase ii-tfiis complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3h3v ( Chain: B) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 2e2i ( Chain: A) Rna polymerase ii elongation complex in 5 mm mg+2 with 2'- dgtp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3i4m ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 3gtj ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 2r92 ( Chain: A) Elongation complex of rna polymerase ii with artificial rdrp scaffold PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 2b8k ( Chain: A) -subunit rna polymerase ii PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1i6h ( Chain: A) Rna polymerase ii elongation complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3hox ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 1sfo ( Chain: A) Rna polymerase ii strand separated elongation complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 1y1v ( Chain: A) Refined rna polymerase ii-tfiis complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH 3gtg ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.009195 22 33 View alignment SCOP MMDB CATH 1y1w ( Chain: A) Complete rna polymerase ii elongation complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.009195 22 33 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP159	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YIL115C	SGD Systematic Sequence
854691	NCBI: Gene ID
NP_012151.1	NCBI: RefSeq protein version ID
NP_012151.1	NCBI: RefSeq protein version ID
6322076	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
76 curated references; 0 references not yet curated
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP188 |MORE
Protein-protein Interactions	Luo Y, et al. (2010) Resolving the Composition of Protein Complexes Using a MALDI LTQ Orbitrap. J Am Soc Mass Spectrom 21(1):34-46	|APL1 |APL3 |APM4 |APS2 |ASM4 |BMH2 |EDE1 |FKS1 |NIC96 |NSP1 |NUP120 |NUP133 |NUP145 |NUP170 |MORE
Protein-protein Interactions	Beliakova-Bethell N, et al. (2009) Ty3 nuclear entry is initiated by viruslike particle docking on GLFG nucleoporins. J Virol 83(22):11914-25	|NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP42 |NUP49 |NUP57 |YGR109W-A |YGR109W-B |YIL080W |YIL082W |YIL082W-A
Evolution Non-Fungal Related Genes/Proteins	DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30	|MLP1 |MLP2 |NIC96 |NUP120 |NUP133 |NUP145 |NUP157 |NUP170 |NUP188 |NUP192 |NUP2 |NUP82 |NUP84 |NUP85
Cellular Location Strains/Constructs	Flemming D, et al. (2009) Two structurally distinct domains of the nucleoporin Nup170 cooperate to tether a subset of nucleoporins to nuclear pores. J Cell Biol 185(3):387-95	|NUP1 |NUP157 |NUP170 |NUP188 |NUP2 |NUP82 |POM152 |POM34
Cellular Location Regulation of	Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73	|APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP100 |NUP133 |NUP157 |NUP170 |MORE
Mutants/Phenotypes Strains/Constructs	Bolger TA, et al. (2008) The mRNA export factor Gle1 and inositol hexakisphosphate regulate distinct stages of translation. Cell 134(4):624-33	|ARG82 |DBP5 |GLE1 |IPK1 |NAB2 |NIP1 |NUP116 |PRT1 |SUP35 |SUP45 |TIF35
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Protein-protein Interactions	Tarassov K, et al. (2008) An in vivo map of the yeast protein interactome. Science 320(5882):1465-70	|ACT1 |ARC40 |ARP2 |ATG27 |BEM1 |CDC11 |CHC1 |DHH1 |FMP42 |GYL1 |KEL1 |KEL2 |LAS17 |LSM4 |MORE
Mutants/Phenotypes	Thomsen R, et al. (2008) General, rapid, and transcription-dependent fragmentation of nucleolar antigens in S. cerevisiae mRNA export mutants. RNA 14(4):706-16	|ASM4 |HPR1 |HSP104 |MEX67 |MFT1 |NOP1 |NOP58 |NSR1 |NUP100 |NUP120 |NUP133 |NUP188 |NUP2 |NUP42 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Yao W, et al. (2008) A versatile interaction platform on the Mex67-Mtr2 receptor creates an overlap between mRNA and ribosome export. EMBO J 27(1):6-16	|MEX67 |MTR2 |NMD3 |NUP116 |NUP120 |NUP145 |NUP82 |NUP84 |NUP85 |SEC13 |SEH1
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP170 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP170 |MORE
Alias Mutants/Phenotypes Strains/Constructs	Brykailo MA, et al. (2007) Analysis of a predicted nuclear localization signal: implications for the intracellular localization and function of the Saccharomyces cerevisiae RNA-binding protein Scp160. Nucleic Acids Res 35(20):6862-9	|CRM1 |EAP1 |MEX67 |RPO21 |SCP160
Evolution Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure	Denning DP and Rexach MF (2007) Rapid evolution exposes the boundaries of domain structure and function in natively unfolded FG nucleoporins. Mol Cell Proteomics 6(2):272-82	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP2 |NUP42 |NUP49 |NUP53 |NUP57 |NUP60
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |MORE
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP157 |NUP170 |NUP192 |NUP2 |MORE
Cellular Location Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure	Stelter P, et al. (2007) Molecular basis for the functional interaction of dynein light chain with the nuclear-pore complex. Nat Cell Biol 9(7):788-96	|DYN1 |DYN2 |NSP1 |NUP133 |NUP82 |PEX14
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	West M, et al. (2007) Novel interaction of the 60S ribosomal subunit export adapter Nmd3 at the nuclear pore complex. J Biol Chem 282(19):14028-37	|CRM1 |NIC96 |NMD3 |NUP82 |NUP85
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP170 |NUP188 |NUP192 |MORE
Cellular Location Protein Processing/Modification/Regulation Regulation of	Madrid AS, et al. (2006) The role of the integral membrane nucleoporins Ndc1p and Pom152p in nuclear pore complex assembly and function. J Cell Biol 173(3):361-71	|ASM4 |NDC1 |NPL3 |NUP60 |POM152 |POM34
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miao M, et al. (2006) The integral membrane protein pom34p functionally links nucleoporin subcomplexes. Genetics 172(3):1441-57	|ASM4 |GLE2 |NSP1 |NUP100 |NUP116 |NUP120 |NUP170 |NUP188 |NUP2 |NUP49 |NUP57 |NUP82 |POM152 |POM34 |MORE
Genetic Interactions Mutants/Phenotypes	Weirich CS, et al. (2006) Activation of the DExD/H-box protein Dbp5 by the nuclear-pore protein Gle1 and its coactivator InsP6 is required for mRNA export. Nat Cell Biol 8(7):668-76	|ARG82 |DBP5 |GLE1 |IPK1 |NUP42 |PLC1
Protein Processing/Modification/Regulation	Gruhler A, et al. (2005) Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway. Mol Cell Proteomics 4(3):310-27	|ADR1 |AFR1 |AHP1 |BEM3 |BOI2 |BUD4 |CDC15 |CDC19 |CDC28 |CHD1 |COG3 |CRP1 |CUE2 |CYR1 |MORE
Protein Physical Properties Protein-protein Interactions Strains/Constructs	Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51	|GLE2 |KAP123 |MEX67 |MLP1 |NIC96 |NSP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP170 |NUP49 |NUP57 |MORE
Non-Fungal Related Genes/Proteins Protein Processing/Modification/Regulation	Mason DA, et al. (2005) Increased nuclear envelope permeability and Pep4p-dependent degradation of nucleoporins during hydrogen peroxide-induced cell death. FEMS Yeast Res 5(12):1237-51	|MCA1 |NSP1 |NUP1 |NUP100 |NUP116 |NUP53 |NUP84 |NUP85 |PAI3 |PEP4 |POM152 |PRB1 |SEH1
Mutants/Phenotypes Strains/Constructs	Aye M, et al. (2004) Host factors that affect Ty3 retrotransposition in Saccharomyces cerevisiae. Genetics 168(3):1159-76	|AIM5 |AMS1 |BRO1 |CDC39 |CDH1 |CKA1 |CRG1 |CYR1 |DAP1 |DML1 |ECM30 |FLC2 |FLO5 |FRE3 |MORE
Function/Process Protein Physical Properties Protein-protein Interactions	Kiseleva E, et al. (2004) Yeast nuclear pore complexes have a cytoplasmic ring and internal filaments. J Struct Biol 145(3):272-88	|NSP1 |NUP116 |NUP49 |NUP57
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miller AL, et al. (2004) Cytoplasmic inositol hexakisphosphate production is sufficient for mediating the Gle1-mRNA export pathway. J Biol Chem 279(49):51022-32	|GLE1 |GLE2 |IPK1 |MSS4 |NUP116 |NUP42
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features	Thakurta AG, et al. (2004) Conserved nuclear export sequences in Schizosaccharomyces pombe Mex67 and human TAP function in mRNA export by direct nuclear pore interactions. J Biol Chem 279(17):17434-42	|GLE2 |MEX67
Genetic Interactions Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Weirich CS, et al. (2004) The N-terminal domain of Nup159 forms a beta-propeller that functions in mRNA export by tethering the helicase Dbp5 to the nuclear pore. Mol Cell 16(5):749-60	|DBP5
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Thomsen R, et al. (2003) Localization of nuclear retained mRNAs in Saccharomyces cerevisiae. RNA 9(9):1049-57	|NPL3 |RRP6 |SSA4
Protein-protein Interactions Techniques and Reagents	Allen NP, et al. (2002) Deciphering networks of protein interactions at the nuclear pore complex. Mol Cell Proteomics 1(12):930-46	|CRM1 |CSE1 |GSP1 |KAP95 |MEX67 |NUP100 |NUP116 |NUP120 |NUP133 |NUP2 |NUP49 |NUP84 |NUP85 |PAB1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Gleizes PE, et al. (2001) Ultrastructural localization of rRNA shows defective nuclear export of preribosomes in mutants of the Nup82p complex. J Cell Biol 155(6):923-36	|DBP5 |GLE1 |GSP1 |NSP1 |NUP82 |NUP84
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Grosshans H, et al. (2001) Biogenesis of the signal recognition particle (SRP) involves import of SRP proteins into the nucleolus, assembly with the SRP-RNA, and Xpo1p-mediated export. J Cell Biol 153(4):745-62	|CRM1 |DIS3 |KAP123 |MEX67 |MTR10 |NSP1 |NUP85 |PSE1 |RNA1 |RRP4 |SCR1 |SEC65 |SRM1 |SRP1 |MORE
Alias Function/Process Mutants/Phenotypes Strains/Constructs	Hilleren P and Parker R (2001) Defects in the mRNA export factors Rat7p, Gle1p, Mex67p, and Rat8p cause hyperadenylation during 3'-end formation of nascent transcripts. RNA 7(5):753-64	|DBP5 |GLE1 |MEX67
Function/Process Substrates/Ligands/Cofactors	Jensen TH, et al. (2001) A block to mRNA nuclear export in S. cerevisiae leads to hyperadenylation of transcripts that accumulate at the site of transcription. Mol Cell 7(4):887-98	|DBP5 |GLE1 |HSP104 |MEX67 |MTR2 |NUP42 |SSA4
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Jungwirth H, et al. (2001) Diazaborine treatment of Baker's yeast results in stabilization of aberrant mRNAs. J Biol Chem 276(39):36419-24	|AFG2 |KEM1 |NAM7
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Cellular Location Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Bailer SM, et al. (2000) Nup116p associates with the Nup82p-Nsp1p-Nup159p nucleoporin complex. J Biol Chem 275(31):23540-8	|GLE2 |NSP1 |NUP116 |NUP82
Function/Process Mutants/Phenotypes Strains/Constructs	Brodsky AS and Silver PA (2000) Pre-mRNA processing factors are required for nuclear export. RNA 6(12):1737-49	|ASH1 |CRM1 |MEX67 |MUD1 |PAP1 |PGK1 |PRP16 |PRP22 |RNA1 |RNA14 |RNA15 |RPL25 |SRM1 |SSA4
Alias Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Das B, et al. (2000) The role of nuclear cap binding protein Cbc1p of yeast in mRNA termination and degradation. Mol Cell Biol 20(8):2827-38	|CBC2 |CYC1 |NAM7 |STO1
Cellular Location Protein-protein Interactions	Ho AK, et al. (2000) Assembly and preferential localization of Nup116p on the cytoplasmic face of the nuclear pore complex by interaction with Nup82p. Mol Cell Biol 20(15):5736-48	|GLE1 |NSP1 |NUP116 |NUP82
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Reviews	Ryan KJ and Wente SR (2000) The nuclear pore complex: a protein machine bridging the nucleus and cytoplasm. Curr Opin Cell Biol 12(3):361-71	|CRM1 |GLE1 |KAP104 |KAP123 |KAP95 |LOS1 |MSN5 |MTR10 |NIC96 |NMD5 |NSP1 |NUP116 |NUP170 |NUP82 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89	|CRM1 |CSE1 |DBP5 |FAL1 |GLE1 |GLE2 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR2 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Strasser K, et al. (2000) Binding of the Mex67p/Mtr2p heterodimer to FXFG, GLFG, and FG repeat nucleoporins is essential for nuclear mRNA export. J Cell Biol 150(4):695-706	|GLE2 |MEX67 |MTR2 |NSP1 |NUP116 |NUP42
Function/Process Mutants/Phenotypes Strains/Constructs	Vainberg IE, et al. (2000) Nuclear export of heat shock and non-heat-shock mRNA occurs via similar pathways. Mol Cell Biol 20(11):3996-4005	|GLE1 |MTR2 |NUP42 |RNA1 |SRM1
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Hodge CA, et al. (1999) Rat8p/Dbp5p is a shuttling transport factor that interacts with Rat7p/Nup159p and Gle1p and suppresses the mRNA export defect of xpo1-1 cells. EMBO J 18(20):5778-88	|CRM1 |DBP5 |GFD1 |GLE1 |GSP1 |MEX67 |NUP42
Alias Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Krebber H, et al. (1999) Uncoupling of the hnRNP Npl3p from mRNAs during the stress-induced block in mRNA export. Genes Dev 13(15):1994-2004	|CRM1 |MTR10 |NPL3 |NUP42
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Schmitt C, et al. (1999) Dbp5, a DEAD-box protein required for mRNA export, is recruited to the cytoplasmic fibrils of nuclear pore complex via a conserved interaction with CAN/Nup159p. EMBO J 18(15):4332-47	|DBP5
Protein-protein Interactions	Seedorf M, et al. (1999) Interactions between a nuclear transporter and a subset of nuclear pore complex proteins depend on Ran GTPase. Mol Cell Biol 19(2):1547-57	|CRM1 |GLE2 |GSP1 |KAP95 |NSP1 |NUP1 |NUP116 |NUP145 |NUP82 |POM152 |PSE1 |RNA1 |SRM1 |SRP1 |MORE
Reviews	Strasser K and Hurt E (1999) Nuclear RNA export in yeast. FEBS Lett 452(1-2):77-81	|GLE1 |MEX67 |MTR10 |MTR2 |NPL3 |NSP1 |NUP120 |NUP145 |NUP82 |NUP85
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Belgareh N, et al. (1998) Functional characterization of a Nup159p-containing nuclear pore subcomplex. Mol Biol Cell 9(12):3475-92	|NIC96 |NSP1 |NUP82
Cellular Location Function/Process Techniques and Reagents	Bucci M and Wente SR (1998) A novel fluorescence-based genetic strategy identifies mutants of Saccharomyces cerevisiae defective for nuclear pore complex assembly. Mol Biol Cell 9(9):2439-61	|GLE2 |NIC96 |NSP1 |NUP116 |NUP120 |NUP145 |NUP49 |NUP57 |NUP82 |POM152
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Hurwitz ME, et al. (1998) Two yeast nuclear pore complex proteins involved in mRNA export form a cytoplasmically oriented subcomplex. Proc Natl Acad Sci U S A 95(19):11241-5	|GLE1 |NUP82
Function/Process	Sarkar S and Hopper AK (1998) tRNA nuclear export in saccharomyces cerevisiae: in situ hybridization analysis. Mol Biol Cell 9(11):3041-55	|LOS1 |NUP116 |RNA1
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Strains/Constructs	Del Priore V, et al. (1997) A structure/function analysis of Rat7p/Nup159p, an essential nucleoporin of Saccharomyces cerevisiae. J Cell Sci 110 ( Pt 23):2987-99
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Protein-protein Interactions	Pemberton LF, et al. (1997) A distinct and parallel pathway for the nuclear import of an mRNA-binding protein. J Cell Biol 139(7):1645-53	|MTR10 |NPL3
Function/Process	Saavedra CA, et al. (1997) Yeast heat shock mRNAs are exported through a distinct pathway defined by Rip1p. Genes Dev 11(21):2845-56	|GLE1 |GSP1 |NPL3 |NUP120 |NUP145 |NUP2 |NUP42 |SSA1 |SSA4
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP170 |NUP188 |NUP2 |NUP42 |NUP49 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Del Priore V, et al. (1996) The product of the Saccharomyces cerevisiae RSS1 gene, identified as a high-copy suppressor of the rat7-1 temperature-sensitive allele of the RAT7/NUP159 nucleoporin, is required for efficient mRNA export. Mol Biol Cell 7(10):1601-21	|GLE1
Reviews	Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Protein-protein Interactions	Stutz F, et al. (1996) A role for nucleoporin FG repeat domains in export of human immunodeficiency virus type 1 Rev protein and RNA from the nucleus. Mol Cell Biol 16(12):7144-50	|NUP100 |NUP116 |NUP145 |NUP42 |NUP49 |NUP57
Reviews	Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Reviews	Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41	|NIC96 |NUP100 |NUP116 |NUP133 |NUP188 |NUP2 |NUP57 |NUP82 |NUP84 |NUP85 |POM152
Alias Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Gorsch LC, et al. (1995) A conditional allele of the novel repeat-containing yeast nucleoporin RAT7/NUP159 causes both rapid cessation of mRNA export and reversible clustering of nuclear pore complexes. J Cell Biol 129(4):939-55
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Heath CV, et al. (1995) Nuclear pore complex clustering and nuclear accumulation of poly(A)+ RNA associated with mutation of the Saccharomyces cerevisiae RAT2/NUP120 gene. J Cell Biol 131(6 Pt 2):1677-97	|NUP120 |NUP133
Cellular Location Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Protein-protein Interactions Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents	Kraemer DM, et al. (1995) The essential yeast nucleoporin NUP159 is located on the cytoplasmic side of the nuclear pore complex and serves in karyopherin-mediated binding of transport substrate. J Biol Chem 270(32):19017-21

Return to SGD

Send a Message to the SGD Curators