PRM2/YIL037C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIX: 284998 to 283028
CDS: 284998 - 283028

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

PRM2 YIL037C ORF, Verified S000001299

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2000-09-05. Gene name expires on 2001-09-05.
Description
Pheromone-regulated protein, predicted to have 4 transmembrane segments and a coiled coil domain; regulated by Ste12p; required for efficient nuclear fusion

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2001-01-19 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
karyogamy during conjugation with cellular fusion Lahav R, et al. (2007) Role of transcription factor Kar4 in regulating downstream events in the Saccharomyces cerevisiae pheromone response pathway. Mol Cell Biol 27(3):818-29
       IMP : Inferred from Mutant Phenotype
Assigned on 2009-08-21 SGD
sexual reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
integral to membrane Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forPRM2/YIL037C for PRM2
1) Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

2) White JM and Rose MD (2001) Yeast mating: getting close to membrane merger. Curr Biol 11(1):R16-20

3) Lahav R, et al. (2007) Role of transcription factor Kar4 in regulating downstream events in the Saccharomyces cerevisiae pheromone response pathway. Mol Cell Biol 27(3):818-29

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PRM2/YIL037C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PRM2/YIL037C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MNNVHII

C-term IFIILKL

Length(aa) 656

MW(Da) 75,020

pI 8.09

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.041

Codon Adaptation Index 0.104

Frequency of Optimal Codons 0.405

Hydropathicity of Protein -0.078

Aromaticity Score 0.104

10 20 30 40 50 | | | | | MNNVHIIKPLSLPQRFFSCIFHPLLLIFFTSVILTIWGSFSVIDITMAKM SHAQVKRNDTVSTFASISTATATATTTATTTATMTAVTTQHAIYSANSYS LNKTFIDNTIDQYFESKLRSIESTVGTDMQEKFKSYTDDILDNKQKLIND QISLETELIKEVLEVNNTIFNELLTKSQLINDTWNEISEDAMTIDKDSIS QMASNLLLNYSMFDSIFGNYSRKLKSLQNFNGTITDFSTQLDTSSTLSLN FLRNSTDWLQLKRNFTANLQNEISILSGGSTEVTSSTSIIKRSLKTNSEE NSVLSAVKNHVFRKCKRMTIIFTVMYFAFVILLMAIERILFQLENQQVNL VMSQINGLTGQTNFTKYNKVLKSLITTLNLSTLYPIPYQLTKLINQKIFK REPEKIDDKKVKKSKLFYCNWWIISNGAHLWLFGFLMLLIHWQIVTRLTN FEVPSLPTFHKRAGPSLYKREVWTDGNITTTIEGFINDSVSLLCENFQME VNEKFITANLSLQTDPNLKVQSTDILNLWVNDTNTQFEKYLNESSQNWQG IDLQVEPLLGSDSINEFLGQYFLPTYEVTNTNSSFALDIQKYGIINRGIN ITNASVAALSSLSKRQIKDKEQKQTYFLHTVYKWGLLAVCLTILFHHMLI FIILKL*

Protein Structures from PDB: proteins of known structure with sequence similarity to PRM2/YIL037C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
PRM2 2000-10-30 Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Standard Name	Date Standardized	Reference
PRM2	2000-10-30	Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YIL037C SGD Systematic Sequence

854774 NCBI: Gene ID

NP_012227.1 NCBI: RefSeq protein version ID

NP_012227.1 NCBI: RefSeq protein version ID

6322152 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YIL037C	SGD Systematic Sequence
854774	NCBI: Gene ID
NP_012227.1	NCBI: RefSeq protein version ID
NP_012227.1	NCBI: RefSeq protein version ID
6322152	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
DNA & RNA Details
Topic Research Highlight Reference Contributor
Other DNA & RNA Details Description: Specifically higher expression in nitrogen limited chemostat cultures versus nitrogen excess.
otherTopic: expression
Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74
Viktor Boer
2003-07-25
Other DNA & RNA Details Description: Specifically lower expression in phosphorus limited chemostat cultures versus phosphorus excess.
otherTopic: expression
Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74
Viktor Boer
2003-07-25

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
10 curated references; 0 references not yet curated
RNA Levels and Processing
Regulation of
Transcription
Kitchen CM, et al. (2009) The mating response cascade does not modulate changes in the steady-state level of target mRNAs through control of mRNA stability. Yeast 26(5):261-72
       |BAR1 |ECM18 |FIG1 |FIG2 |FUS1 |FUS2 |PRM6 |RPO21 |STE12
DNA/RNA Sequence Features
Function/Process
Mutants/Phenotypes
Regulation of
Strains/Constructs
Transcription
Lahav R, et al. (2007) Role of transcription factor Kar4 in regulating downstream events in the Saccharomyces cerevisiae pheromone response pathway. Mol Cell Biol 27(3):818-29
       |AFI1 |CDA2 |CIK1 |CIS3 |ECM23 |IME4 |ISC1 |JJJ2 |KAR3 |KAR4 |PHM6 |RRT16 |SPC25 |SRL4 |MORE
DNA/RNA Sequence Features
Regulation of
Chou S, et al. (2006) Regulation of mating and filamentation genes by two distinct Ste12 complexes in Saccharomyces cerevisiae. Mol Cell Biol 26(13):4794-805
       |AFR1 |AGA1 |ASG7 |BAR1 |CHS7 |CIK1 |CLN1 |CWP1 |DDR48 |DIG1 |DIG2 |FIG1 |FUS1 |FUS2 |MORE
Function/Process
Other Features
Protein/Nucleic Acid Structure
Ferre S and King RD (2006) Finding motifs in protein secondary structure for use in function prediction. J Comput Biol 13(3):719-31
       |AFG2 |ANT1 |CFD1 |COS8 |CSM2 |CSN12 |CUE3 |DBP9 |DSL1 |ESL1 |GIP4 |HAL9 |MON1 |PNC1 |MORE
RNA Levels and Processing
Regulation of
Transcription
Translational Regulation
Law GL, et al. (2005) The undertranslated transcriptome reveals widespread translational silencing by alternative 5' transcript leaders. Genome Biol 6(13):R111
       |ALD3 |AMD2 |APA2 |AQY1 |ARG80 |ARO80 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |ATG13 |ATG5 |BCK1 |CCZ1 |MORE
RNA Levels and Processing
Regulation of
Ohkuni K, et al. (2003) Genome-wide expression analysis of NAP1 in Saccharomyces cerevisiae. Biochem Biophys Res Commun 306(1):5-9
       |CLN1 |CMR1 |DIG2 |GLC3 |GSY1 |NAP1 |PCL1 |PRM1 |SEO1 |SLI15 |SNZ2 |THI72 |TMA10 |TOS2 |MORE
Regulation of
Zeitlinger J, et al. (2003) Program-specific distribution of a transcription factor dependent on partner transcription factor and MAPK signaling. Cell 113(3):395-404
             |ACT1 |ADE1 |AFR1 |AGA1 |ASG7 |BEM1 |BEM2 |BMH1 |BUD14 |BUD8 |CHS1 |CHS7 |CIK1 |CLA4 |MORE
RNA Levels and Processing
Regulation of
Harris K, et al. (2001) Role of scaffolds in MAP kinase pathway specificity revealed by custom design of pathway-dedicated signaling proteins. Curr Biol 11(23):1815-24
             |AFR1 |AGA1 |ARI1 |ASG7 |CIK1 |CRG1 |CWP1 |DAK1 |DSF1 |FUS1 |FUS2 |GPD1 |GRE2 |HYM1 |MORE
Reviews
White JM and Rose MD (2001) Yeast mating: getting close to membrane merger. Curr Biol 11(1):R16-20
       |PRM1 |PRM3 |PRM4 |PRM6 |VAM3 |VAM7
Function/Process
Protein Sequence Features
Regulation of
Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       |AGA1 |PRM1 |PRM10 |PRM3 |PRM4 |PRM5 |PRM6 |PRM7 |PRM8 |PRM9

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.