---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ERG9/YHR190W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVIII: 484845 to 486179 CDS: 484845 - 486179 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ERG9	YHR190W		ORF, Verified	S000001233
Description
Farnesyl-diphosphate farnesyl transferase (squalene synthase), joins two farnesyl pyrophosphate moieties to form squalene in the sterol biosynthesis pathway

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By catalytic activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0511 Assigned on 2007-05-23 UniProtKB farnesyl-diphosphate farnesyltransferase activity Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006449 Assigned on 2007-05-23 UniProtKB GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.5.1.21 Assigned on 2007-05-23 UniProtKB magnesium ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0460 Assigned on 2007-05-23 UniProtKB oxidoreductase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2007-05-23 UniProtKB transferase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002060 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By alcohol metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002060 Assigned on 2007-05-23 UniProtKB cellular lipid metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cholesterol biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0152 Assigned on 2007-05-23 UniProtKB ergosterol biosynthetic process Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD isoprenoid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0414 Assigned on 2007-05-23 UniProtKB lipid biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006449 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0444 Assigned on 2007-05-23 UniProtKB oxidation reduction GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2008-05-21 UniProtKB steroid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0752 Assigned on 2007-05-23 UniProtKB sterol biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0756 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006449 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB mitochondrial outer membrane Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50          IDA : Inferred from Direct Assay Assigned on 2006-03-17 SGD

Pathways [TOP] [NEXT]
ergosterol biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ERG9/YHR190W for ERG9 ERG9 encodes farnesyl-diphosphate farnesyl transferase (also called squalene synthase), an enzyme that joins two farnesyl pyrophosphate moieties to form squalene, a reaction in the sterol biosynthesis pathway (1, 2, 3, 4, 5). erg9 null mutants lack farnesyl-diphosphate farnesyl transferase activity (2), and are ergosterol auxotrophs (6). Synthesis of polyprenols is elevated in erg9 mutants, suggesting that Erg9p may have a regulatory role (6). ERG9 expression is increased by mutations in genes encoding other sterol biosynthetic enzymes (7). The erg9 null phenotype can be complemented by expression of homolgos from S. pombe, Nicotiana benthamiana, and Yarrowia lipolytica (8, 9, 10). Last Updated: 2000-08-29

Basic References [TOP]

BASIC INFORMATION REFERENCES forERG9/YHR190W for ERG9 1) Fegueur M, et al. (1991) Isolation and primary structure of the ERG9 gene of Saccharomyces cerevisiae encoding squalene synthetase. Curr Genet 20(5):365-72      2) Jennings SM, et al. (1991) Molecular cloning and characterization of the yeast gene for squalene synthetase. Proc Natl Acad Sci U S A 88(14):6038-42        3) Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    4) Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30      5) Stryer L (1995) Biochemistry (4th ed.). New York: W. H. Freeman and Company    6) Grabowska D, et al. (1998) Effect of squalene synthase gene disruption on synthesis of polyprenols in Saccharomyces cerevisiae. FEBS Lett 434(3):406-8        7) Kennedy MA, et al. (1999) Transcriptional regulation of the squalene synthase gene (ERG9) in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1445(1):110-22      8) Robinson GW, et al. (1993) Conservation between human and fungal squalene synthetases: similarities in structure, function, and regulation. Mol Cell Biol 13(5):2706-17      9) Hanley KM, et al. (1996) Molecular cloning, in vitro expression and characterization of a plant squalene synthetase cDNA. Plant Mol Biol 30(6):1139-51      10) Merkulov S, et al. (2000) Cloning and characterization of the Yarrowia lipolytica squalene synthase (SQS1) gene and functional complementation of the Saccharomyces cerevisiae erg9 mutation. Yeast 16(3):197-206        11) Karst F and Lacroute F (1977) Ertosterol biosynthesis in Saccharomyces cerevisiae: mutants deficient in the early steps of the pathway. Mol Gen Genet 154(3):269-77

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERG9/YHR190W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERG9/YHR190W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MGKLLQL C-term IYTLHRA Length(aa) 444 MW(Da) 51,719 pI 5.79 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.350   Codon Adaptation Index 0.297   Frequency of Optimal Codons 0.616   Hydropathicity of Protein -0.107   Aromaticity Score 0.108

10 20 30 40 50 | | | | | MGKLLQLALHPVEMKAALKLKFCRTPLFSIYDQSTSPYLLHCFELLNLTS RSFAAVIRELHPELRNCVTLFYLILRALDTIEDDMSIEHDLKIDLLRHFH EKLLLTKWSFDGNAPDVKDRAVLTDFESILIEFHKLKPEYQEVIKEITEK MGNGMADYILDENYNLNGLQTVHDYDVYCHYVAGLVGDGLTRLIVIAKFA NESLYSNEQLYESMGLFLQKTNIIRDYNEDLVDGRSFWPKEIWSQYAPQL KDFMKPENEQLGLDCINHLVLNALSHVIDVLTYLAGIHEQSTFQFCAIPQ VMAIATLALVFNNREVLHGNVKIRKGTTCYLILKSRTLRGCVEIFDYYLR DIKSKLAVQDPNFLKLNIQISKIEQFMEEMYQDKLPPNVKPNETPIFLKV KERSRYDDELVPTQQEEEYKFNMVLSIILSVLLGFYYIYTLHRA*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERG9/YHR190W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to ERG9 Homolog Source (per PDB) Protein Alignment: ERG9 vs. Homolog External Links P-Value %Identical %Similar Alignment 1ezf ( Chain: B, C, A) Crystal structure of human squalene synthase PDB_Info PDB_Structure Homo sapiens Chain B = 6.4e-61 48 23 View alignment SCOP MMDB CATH Chain C = 6.4e-61 48 23 View alignment Chain A = 6.4e-61 48 23 View alignment 2zcr ( Chain: A) Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-698 PDB_Info PDB_Structure Staphylococcus aureus 0.008395 22 32 View alignment SCOP MMDB CATH 2zcp ( Chain: A, B) Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with farnesyl thiopyrophosphate PDB_Info PDB_Structure Staphylococcus aureus Chain A = 0.008395 22 32 View alignment SCOP MMDB CATH Chain B = 0.008395 22 32 View alignment 2zy1 ( Chain: A) Dehydrosqualene synthas PDB_Info PDB_Structure Unknown 0.008395 22 32 View alignment SCOP MMDB CATH 2zcq ( Chain: A) Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-652 PDB_Info PDB_Structure Staphylococcus aureus 0.008395 22 32 View alignment SCOP MMDB CATH 2zco ( Chain: A) Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus PDB_Info PDB_Structure Staphylococcus aureus 0.008395 22 32 View alignment SCOP MMDB CATH 2zcs ( Chain: A) Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-700 PDB_Info PDB_Structure Staphylococcus aureus 0.008395 22 32 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ERG9	Karst F and Lacroute F (1977) Ertosterol biosynthesis in Saccharomyces cerevisiae: mutants deficient in the early steps of the pathway. Mol Gen Genet 154(3):269-77

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YHR190W	SGD Systematic Sequence
856597	NCBI: Gene ID
NP_012060.1	NCBI: RefSeq protein version ID
NP_012060.1	NCBI: RefSeq protein version ID
6321984	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
61 curated references; 0 references not yet curated
Industrial Applications Mutants/Phenotypes Strains/Constructs	Asadollahi MA, et al. (2010) Enhancement of farnesyl diphosphate pool as direct precursor of sesquiterpenes through metabolic engineering of the mevalonate pathway in Saccharomyces cerevisiae. Biotechnol Bioeng	|HMG1
Reviews	Kuranda K, et al. (2010) The isoprenoid pathway and transcriptional response to its inhibitors in the yeast Saccharomyces cerevisiae. FEMS Yeast Res 10(1):14-27	|COQ1 |COX10 |ERG10 |ERG12 |ERG13 |ERG20 |ERG8 |HMG1 |HMG2 |IDI1 |MOD5 |MVD1 |RAM1 |RAM2 |MORE
Reviews	Peralta-Yahya PP and Keasling JD (2010) Advanced biofuel production in microbes. Biotechnol J	|ADH2 |ADH6 |ERG10 |ERG12 |ERG13 |ERG20 |ERG8 |FAA1 |FAA4 |MVD1
Mutants/Phenotypes Strains/Constructs	Garza RM, et al. (2009) Geranylgeranyl Pyrophosphate Is a Potent Regulator of HRD-dependent 3-Hydroxy-3-methylglutaryl-CoA Reductase Degradation in Yeast. J Biol Chem 284(51):35368-80	|BET2 |BTS1 |CDC43 |CDC48 |HMG1 |HMG2 |HRD1 |MRS6
Alias Cell Growth and Metabolism Industrial Applications Mutants/Phenotypes Strains/Constructs	Muramatsu M, et al. (2009) Alkaline pH enhances farnesol production by Saccharomyces cerevisiae. J Biosci Bioeng 108(1):52-5
Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Pan JJ, et al. (2009) Recombinant squalene synthase. synthesis of cyclopentyl non-head-to-tail triterpenes. J Org Chem 74(19):7562-5
Regulation of Transcription	Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461	|AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
Strains/Constructs	Song L (2009) Recovery of E,E-farnesol from cultures of yeast erg9 mutants: extraction with polymeric beads and purification by normal-phase chromatography. Biotechnol Prog 25(4):1111-4
Industrial Applications Strains/Constructs	Asadollahi MA, et al. (2008) Production of plant sesquiterpenes in Saccharomyces cerevisiae: effect of ERG9 repression on sesquiterpene biosynthesis. Biotechnol Bioeng 99(3):666-77	|MET3
Cross-species Expression Non-Fungal Related Genes/Proteins	Busquets A, et al. (2008) Arabidopsis thaliana contains a single gene encoding squalene synthase. Plant Mol Biol 67(1-2):25-36
RNA Levels and Processing Regulation of	Guo N, et al. (2008) Global gene expression profile of Saccharomyces cerevisiae induced by dictamnine. Yeast 25(9):631-41	|ADE1 |ADE12 |ADE13 |ADE16 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADE8 |ADY2 |APT1 |CBF1 |CIS3 |MORE
Reviews	Huang B, et al. (2008) Heterologous production of secondary metabolites as pharmaceuticals in Saccharomyces cerevisiae. Biotechnol Lett 30(7):1121-37	|DPP1 |ERG10 |ERG12 |ERG13 |ERG20 |ERG8
Function/Process Industrial Applications	Lenihan JR, et al. (2008) Developing an industrial artemisinic acid fermentation process to support the cost-effective production of antimalarial artemisinin-based combination therapies. Biotechnol Prog 24(5):1026-32
Mutants/Phenotypes Strains/Constructs	Muramatsu M, et al. (2008) Accumulation of prenyl alcohols by terpenoid biosynthesis inhibitors in various microorganisms. Appl Microbiol Biotechnol 80(4):589-95
Industrial Applications Mutants/Phenotypes Strains/Constructs	Muramatsu M, et al. (2008) Various oils and detergents enhance the microbial production of farnesol and related prenyl alcohols. J Biosci Bioeng 106(3):263-7
Reviews	Nevoigt E (2008) Progress in Metabolic Engineering of Saccharomyces cerevisiae. Microbiol Mol Biol Rev 72(3):379-412	|ADH1 |ALD4 |ALD5 |CTR1 |CTR3 |CUP1-1 |CUP1-2 |DAN1 |ERG20 |FDH1 |FDH2 |FPS1 |GAL1 |GAL10 |MORE
Cell Growth and Metabolism Function/Process Mutants/Phenotypes Strains/Constructs	Paradise EM, et al. (2008) Redirection of flux through the FPP branch-point in Saccharomyces cerevisiae by down-regulating squalene synthase. Biotechnol Bioeng 100(2):371-8
RNA Levels and Processing	Zara G, et al. (2008) Correlation between cell lipid content, gene expression and fermentative behaviour of two Saccharomyces cerevisiae wine strains. J Appl Microbiol 104(3):906-14	|ACC1 |ACS1 |ACS2 |ARE1 |ARE2 |ERG10 |OLE1
Substrates/Ligands/Cofactors	Daicho K, et al. (2007) The ergosterol biosynthesis inhibitor zaragozic acid promotes vacuolar degradation of the tryptophan permease Tat2p in yeast. Biochim Biophys Acta 1768(7):1681-1690	|ERG1 |ERG11 |ERG6 |PEP12 |PEP4 |RSP5 |TAT2 |VPS1 |VPS27 |VPS45
Fungal Related Genes/Proteins Mutants/Phenotypes	Snoek IS and Steensma HY (2006) Why does Kluyveromyces lactis not grow under anaerobic conditions? Comparison of essential anaerobic genes of Saccharomyces cerevisiae with the Kluyveromyces lactis genome. FEMS Yeast Res 6(3):393-403	|ACP1 |ARB1 |ARG82 |ARH1 |ARV1 |ATM1 |BTS1 |BUR6 |CAB2 |CAX4 |CDC40 |CNM67 |CTF4 |DBP7 |MORE
Mutants/Phenotypes Strains/Constructs	Song L (2006) Reduction of background interference in the spectrophotometric assay of mevalonate kinase. Anal Bioanal Chem 384(6):1444-5	|ERG12
Function/Process Mutants/Phenotypes Strains/Constructs	Szkopinska A, et al. (2006) Interplay between the cis-prenyltransferases and polyprenol reductase in the yeast Saccharomyces cerevisiae. Biochimie 88(3-4):271-6	|ERG20 |RER2 |SRT1
Protein Processing/Modification/Regulation Techniques and Reagents	Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48	|AAC1 |AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |MORE
Cellular Location	Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50	|AFG1 |AIM18 |ALD4 |ALO1 |ATP15 |ATP2 |ATP3 |ATP5 |AYR1 |BNA4 |CBR1 |CIR1 |COR1 |CYB2 |MORE
Mutants/Phenotypes RNA Levels and Processing Techniques and Reagents	Buurman ET, et al. (2005) Utilization of target-specific, hypersensitive strains of Saccharomyces cerevisiae to determine the mode of action of antifungal compounds. Antimicrob Agents Chemother 49(6):2558-60	|AUR1 |ERG1 |ERG11 |ERG7 |ERG8 |LCB1 |PKC1
Protein-protein Interactions Techniques and Reagents	Mo C and Bard M (2005) A systematic study of yeast sterol biosynthetic protein-protein interactions using the split-ubiquitin system. Biochim Biophys Acta 1737(2-3):152-60	|ERG1 |ERG11 |ERG2 |ERG24 |ERG25 |ERG26 |ERG27 |ERG28 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7
Mutants/Phenotypes Strains/Constructs	Beh CT and Rine J (2004) A role for yeast oxysterol-binding protein homologs in endocytosis and in the maintenance of intracellular sterol-lipid distribution. J Cell Sci 117(Pt 14):2983-96	|ARV1 |HES1 |KES1 |OSH2 |OSH3 |OSH6 |OSH7 |SLA2 |SWH1
RNA Levels and Processing Regulation of	Jones DL, et al. (2004) Genome-Wide Analysis of the Effects of Heat Shock on a Saccharomyces cerevisiae Mutant With a Constitutively Activated cAMP-Dependent Pathway. Comp Funct Genomics 5(5):419-31	|BTN2 |COX6 |DCS1 |ENO1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG26 |ERG27 |ERG3 |MORE
RNA Levels and Processing Techniques and Reagents	Krantz M, et al. (2004) Anaerobicity prepares Saccharomyces cerevisiae cells for faster adaptation to osmotic shock. Eukaryot Cell 3(6):1381-90	|ALD2 |ALD3 |ALD4 |ALD6 |CTT1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |MORE
Mutants/Phenotypes Strains/Constructs	Song L (2003) Detection of farnesyl diphosphate accumulation in yeast ERG9 mutants. Anal Biochem 317(2):180-5
Function/Process Regulation of Transcription	Hongay C, et al. (2002) Mot3 is a transcriptional repressor of ergosterol biosynthetic genes and is required for normal vacuolar function in Saccharomyces cerevisiae. EMBO J 21(15):4114-24	|ERG2 |ERG6 |MOT3 |PAN1 |VPS41
DNA/RNA Sequence Features Function/Process Genetic Interactions Regulation of	Kennedy MA and Bard M (2001) Positive and negative regulation of squalene synthase (ERG9), an ergosterol biosynthetic gene, in Saccharomyces cerevisiae. Biochim Biophys Acta 1517(2):177-89	|SLK19 |TPO1 |YER064C
Cellular Location Function/Process	Pichler H, et al. (2001) A subfraction of the yeast endoplasmic reticulum associates with the plasma membrane and has a high capacity to synthesize lipids. Eur J Biochem 268(8):2351-61	|ERG1 |ERG6
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Merkulov S, et al. (2000) Cloning and characterization of the Yarrowia lipolytica squalene synthase (SQS1) gene and functional complementation of the Saccharomyces cerevisiae erg9 mutation. Yeast 16(3):197-206
Fungal Related Genes/Proteins	Nakayama H, et al. (2000) Depletion of the squalene synthase (ERG9) gene does not impair growth of Candida glabrata in mice. Antimicrob Agents Chemother 44(9):2411-8
Reviews	Sturley SL (2000) Conservation of eukaryotic sterol homeostasis: new insights from studies in budding yeast. Biochim Biophys Acta 1529(1-3):155-63	|ARE1 |ARE2 |ARH1 |ARV1 |ECM22 |ERG10 |ERG11 |ERG6 |HMG1 |HMG2 |HMS1 |LRO1 |NCR1 |ROX1 |MORE
Genomic expression study Regulation of	Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60	|ARE1 |ARE2 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG1 |MORE
Non-Fungal Related Genes/Proteins Transcription	Kennedy MA, et al. (1999) Transcriptional regulation of the squalene synthase gene (ERG9) in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1445(1):110-22	|ERG24 |ERG3 |ERG7 |HAP1 |HAP2 |HAP3 |HAP4 |HAP5 |HMG1 |HMG2 |INO2 |INO4 |YAP1
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Mutants/Phenotypes Regulatory Role Strains/Constructs	Grabowska D, et al. (1998) Effect of squalene synthase gene disruption on synthesis of polyprenols in Saccharomyces cerevisiae. FEBS Lett 434(3):406-8
Fungal Related Genes/Proteins	Shimada H, et al. (1998) Increased carotenoid production by the food yeast Candida utilis through metabolic engineering of the isoprenoid pathway. Appl Environ Microbiol 64(7):2676-80	|HMG1
Cross-species Expression Non-Fungal Related Genes/Proteins	Kribii R, et al. (1997) Cloning and characterization of the Arabidopsis thaliana SQS1 gene encoding squalene synthase--involvement of the C-terminal region of the enzyme in the channeling of squalene through the sterol pathway. Eur J Biochem 249(1):61-9
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins	Hanley KM, et al. (1996) Molecular cloning, in vitro expression and characterization of a plant squalene synthetase cDNA. Plant Mol Biol 30(6):1139-51
Function/Process Fungal Related Genes/Proteins Reviews	Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6	|ERG1 |ERG11 |ERG2 |ERG24 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |FEN1 |FEN2
Reviews	Parks LW and Casey WM (1995) Physiological implications of sterol biosynthesis in yeast. Annu Rev Microbiol 49:95-116	|ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |MORE
Reviews	Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30	|ERG1 |ERG10 |ERG11 |ERG12 |ERG2 |ERG20 |ERG24 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG8 |HMG1 |MORE
Function/Process Substrates/Ligands/Cofactors	Mookhtiar KA, et al. (1994) Yeast squalene synthase. A mechanism for addition of substrates and activation by NADPH. J Biol Chem 269(15):11201-7
Function/Process Fungal Related Genes/Proteins	Robinson GW, et al. (1993) Conservation between human and fungal squalene synthetases: similarities in structure, function, and regulation. Mol Cell Biol 13(5):2706-17
Function/Process Mutants/Phenotypes Strains/Constructs	Szkopinska A, et al. (1993) The deficiency of sterol biosynthesis in Saccharomyces cerevisiae affects the synthesis of glycosyl derivatives of dolichyl phosphates. FEMS Microbiol Lett 112(3):325-8	|ERG12 |ERG8 |HEM1 |HEM12
Function/Process Mutants/Phenotypes Protein Physical Properties Strains/Constructs	Zhang D, et al. (1993) Yeast squalene synthase: expression, purification, and characterization of soluble recombinant enzyme. Arch Biochem Biophys 304(1):133-43
Reviews	Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|ACC1 |ACH1 |CDS1 |CHO1 |CHO2 |CKI1 |CTR1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |MORE
DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Fegueur M, et al. (1991) Isolation and primary structure of the ERG9 gene of Saccharomyces cerevisiae encoding squalene synthetase. Curr Genet 20(5):365-72
DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Jennings SM, et al. (1991) Molecular cloning and characterization of the yeast gene for squalene synthetase. Proc Natl Acad Sci U S A 88(14):6038-42
Function/Process Techniques and Reagents	Kuswik-Rabiega G and Rilling HC (1987) Squalene synthetase. Solubilization and partial purification of squalene synthetase, copurification of presqualene pyrophosphate and squalene synthetase activities. J Biol Chem 262(4):1505-9
Function/Process Protein Physical Properties Substrates/Ligands/Cofactors	Hata S, et al. (1982) Effect of detergents on sterol synthesis in a cell-free system of yeast. J Lipid Res 23(6):803-10	|ERG1 |ERG6
Function/Process Protein Physical Properties Techniques and Reagents	Agnew WS and Popjak G (1978) Squalene synthetase. Solubilization from yeast microsomes of a phospholipid-requiring enzyme. J Biol Chem 253(13):4574-83
Function/Process Protein Physical Properties Regulation of Substrates/Ligands/Cofactors	Agnew WS and Popjak G (1978) Squalene synthetase. Stoichiometry and kinetics of presqualene pyrophosphate and squalene synthesis by yeast microsomes. J Biol Chem 253(13):4566-73
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Karst F and Lacroute F (1977) Ertosterol biosynthesis in Saccharomyces cerevisiae: mutants deficient in the early steps of the pathway. Mol Gen Genet 154(3):269-77	|ERG1 |ERG10 |ERG11 |ERG12 |ERG7 |ERG8
Function/Process Non-Fungal Related Genes/Proteins Other Features Substrates/Ligands/Cofactors	Ortiz de Montellano PR, et al. (1977) Substrate selectivity of squalene synthetase. Biochemistry 16(12):2680-5
Protein Physical Properties Substrates/Ligands/Cofactors	Beytia E, et al. (1973) Squalene synthetase. 3. Mechanism of the reaction. J Biol Chem 248(5):1856-67
Protein Physical Properties Substrates/Ligands/Cofactors	Qureshi AA, et al. (1973) Squalene synthetase. II. Purification and properties of bakers' yeast enzyme. J Biol Chem 248(5):1848-55

Return to SGD

Send a Message to the SGD Curators