EPT1/YHR123W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVIII: 354818 to 356084
intron: 354868 - 354958
CDS: 354818 - 354867, 354959 - 356084

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

EPT1 YHR123W ORF, Verified S000001165

Description
sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferase; not essential for viability

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
catalytic activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0511
Assigned on 2007-05-23 UniProtKB
diacylglycerol cholinephosphotransferase activity GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
     IEA : Inferred from Electronic Annotation with IUBMB:2.7.8.2
Assigned on 2008-02-13 UniProtKB
ethanolaminephosphotransferase activity Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   TAS : Traceable Author Statement
Assigned on 2001-01-19 SGD
GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
     IEA : Inferred from Electronic Annotation with IUBMB:2.7.8.1
Assigned on 2007-05-23 UniProtKB
phosphotransferase activity, for other substituted phosphate groups DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR000462
Assigned on 2007-05-23 UniProtKB
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
phosphatidylethanolamine biosynthetic process Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   TAS : Traceable Author Statement
Assigned on 2001-01-19 SGD
phospholipid biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR000462
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0594
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
Golgi apparatus Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7
             RCA : Reviewed Computational Analysis
Assigned on 2009-09-03 YeastFunc
endoplasmic reticulum Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   TAS : Traceable Author Statement
Assigned on 2001-01-19 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0095
Assigned on 2008-02-13 UniProtKB
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR000462
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
microsome GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0492
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
phospholipid biosynthesis II (Kennedy pathway)
superpathway of phospholipid biosynthesis

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forEPT1/YHR123W for EPT1
1) Hjelmstad RH and Bell RM (1988) The sn-1,2-diacylglycerol ethanolaminephosphotransferase activity of Saccharomyces cerevisiae. Isolation of mutants and cloning of the EPT1 gene. J Biol Chem 263(36):19748-57

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for EPT1/YHR123W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for EPT1/YHR123W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MGYFVPD

C-term IKRSKLT

Length(aa) 391

MW(Da) 44,559

pI 6.5

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.033

Codon Adaptation Index 0.122

Frequency of Optimal Codons 0.435

Hydropathicity of Protein 0.424

Aromaticity Score 0.161

10 20 30 40 50 | | | | | MGYFVPDSHIENLKSYKYQSEDRSLVSKYFLKPFWQRFCHIFPTWMAPNI ITLSGFAFIVINVLTVFYYDPNLNTDTPRWTYFSYALGVFLYQTFDGCDG VHARRINQSGPLGELFDHSIDAINSTLSIFIFASETGMGFSYNLMLSQFA MLTNFYLSTWEEYHTHTLYLSEFSGPVEGILIVCVSLILTGIYGKQVIWH TYLFTITVGDKVIDVDTLDIVFSLAVFGLVMNALSAKRNVDKYYRNSTSS ANNITQIEQDSAIKGLLPFFAYYASIALLVWMQPSFITLSFILSVGFTGA FTVGRIIVCHLTKQSFPMFNAPMLIPLCQIVLYKICLSLWGIESNKIVFA LSWLGFGLSLGVHIMFMNDIIHEFTEYLDVYALSIKRSKLT*

Protein Structures from PDB: proteins of known structure with sequence similarity to EPT1/YHR123W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
EPT1 SGD (2007) Information without a citation in SGD

Standard Name	Reference
EPT1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YHR123W SGD Systematic Sequence

856523 NCBI: Gene ID

NP_011991.1 NCBI: RefSeq protein version ID

NP_011991.1 NCBI: RefSeq protein version ID

6321915 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YHR123W	SGD Systematic Sequence
856523	NCBI: Gene ID
NP_011991.1	NCBI: RefSeq protein version ID
NP_011991.1	NCBI: RefSeq protein version ID
6321915	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
35 curated references; 0 references not yet curated
Cross-species Expression
Non-Fungal Related Genes/Proteins
Strains/Constructs
Sutoh K, et al. (2010) Specific induction of TaAAPT1, an ER- and Golgi-localized ECPT-type aminoalcoholphosphotransferase, results in preferential accumulation of the phosphatidylethanolamine membrane phospholipid during cold acclimation in wheat. Plant Mol Biol 72(4-5):519-31
       |CPT1
Strains/Constructs
Techniques and Reagents
Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif
       |AAC1 |AAC3 |ADP1 |ALG3 |ALG7 |BOR1 |CHO1 |DGA1 |DPP1 |ENA5 |GPT2 |LPP1 |NFT1 |PDR10 |MORE
Regulation of
Transcription
Cheraiti N, et al. (2008) Acetaldehyde addition throughout the growth phase alleviates the phenotypic effect of zinc deficiency in Saccharomyces cerevisiae. Appl Microbiol Biotechnol 77(5):1093-1109
       |AAD14 |AAD15 |AAD16 |AAD3 |AAD4 |AAH1 |ACH1 |ADH1 |ADH4 |ALD3 |ALO1 |ARG3 |ARO1 |ASC1 |MORE
Reviews
Sugimoto H, et al. (2008) Transcriptional regulation of phosphatidylcholine biosynthesis. Prog Lipid Res 47(3):204-20
       |CDS1 |CHO1 |CHO2 |CPT1 |INO1 |INO2 |INO4 |OPI1 |OPI3 |PSD1 |PSD2
Reviews
Carman GM and Han GS (2007) Regulation of phospholipid synthesis in Saccharomyces cerevisiae by zinc depletion. Biochim Biophys Acta 1771(3):322-30
       |CDS1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |DPP1 |EKI1 |INM1 |INO1 |OPI1 |OPI3 |PAH1 |PCT1 |MORE
Mutants/Phenotypes
Choi HS and Carman GM (2007) Respiratory deficiency mediates the regulation of CHO1-encoded phosphatidylserine synthase by mRNA stability in Saccharomyces cerevisiae. J Biol Chem 282(43):31217-27
     |CCR4 |CHO1 |CKI1 |COX4 |DCP1 |EKI1 |KEM1 |MUQ1
Regulation of
Transcription
Ernst J, et al. (2007) Reconstructing dynamic regulatory maps. Mol Syst Biol 3():74
         |AFT2 |ARG81 |CBF1 |DAL82 |FHL1 |FKH2 |FYV8 |GCN4 |HSF1 |INO4 |ITR1 |MBP1 |MET32 |MET4 |MORE
Protein Physical Properties
White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36
         |ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |MORE
Reviews
Howe AG and McMaster CR (2006) Regulation of phosphatidylcholine homeostasis by Sec14. Can J Physiol Pharmacol 84(1):29-38
           |CHO2 |CKI1 |CPT1 |INO1 |NTE1 |OPI1 |OPI3 |PCT1 |PLB1 |SCS2 |SEC14 |SPO14
DNA/RNA Sequence Features
RNA Levels and Processing
Regulation of
Transcription
Slattery MG, et al. (2006) The function and properties of the Azf1 transcriptional regulator change with growth conditions in Saccharomyces cerevisiae. Eukaryot Cell 5(2):313-20
           |ADK2 |ADY3 |AIM20 |ANS1 |AQR1 |ARI1 |AZF1 |CIS3 |CLN1 |CLN3 |CPA1 |CRF1 |CSI2 |CYS3 |MORE
Protein-protein Interactions
Millson SH, et al. (2005) A two-hybrid screen of the yeast proteome for Hsp90 interactors uncovers a novel Hsp90 chaperone requirement in the activity of a stress-activated mitogen-activated protein kinase, Slt2p (Mpk1p). Eukaryot Cell 4(5):849-60
         |ACF4 |ACT1 |AGP2 |AHA1 |AIM2 |AIM37 |ANT1 |AQR1 |ARE1 |ARE2 |ARG4 |ARR3 |ASG7 |ATG14 |MORE
Fungal Related Genes/Proteins
Sims AH, et al. (2005) Transcriptome analysis of recombinant protein secretion by Aspergillus nidulans and the unfolded-protein response in vivo. Appl Environ Microbiol 71(5):2737-47
         |BCH2 |INO1 |KAR2 |NCE102 |RPT3 |SEC27 |SEC63 |SEC65 |SEC72 |SHR3 |SLC1 |SRP54 |UBA1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Boumann HA, et al. (2004) The selective utilization of substrates in vivo by the phosphatidylethanolamine and phosphatidylcholine biosynthetic enzymes Ept1p and Cpt1p in yeast. FEBS Lett 569(1-3):173-7
       |CPT1
Mutants/Phenotypes
Strains/Constructs
Roggero R, et al. (2004) Unraveling the mode of action of the antimalarial choline analog G25 in Plasmodium falciparum and Saccharomyces cerevisiae. Antimicrob Agents Chemother 48(8):2816-24
       |CHO2 |CKI1 |CPT1 |EKI1 |HNM1 |MUQ1 |OPI3 |PCT1 |PSD1 |PSD2
Regulation of
Transcription
Zhang W, et al. (2003) Microarray analyses of the metabolic responses of Saccharomyces cerevisiae to organic solvent dimethyl sulfoxide. J Ind Microbiol Biotechnol 30(1):57-69
         |AAH1 |ABP140 |ACS2 |ADE1 |ADE12 |ADE17 |ADE4 |ADE8 |ADH2 |ADH4 |ADH5 |ADK1 |ADO1 |ALD3 |MORE
Function/Process
Fungal Related Genes/Proteins
Substrates/Ligands/Cofactors
Henneberry AL, et al. (2001) Phosphatidylcholine synthesis influences the diacylglycerol homeostasis required for SEC14p-dependent Golgi function and cell growth. Mol Biol Cell 12(3):511-20
       |CPT1 |SEC14
DNA/RNA Sequence Features
Davis CA, et al. (2000) Test of intron predictions reveals novel splice sites, alternatively spliced mRNAs and new introns in meiotically regulated genes of yeast. Nucleic Acids Res 28(8):1700-6
       |AIM11 |AMA1 |AML1 |APE2 |APS3 |ARP9 |ASC1 |BET1 |BIG1 |BOS1 |CDC21 |COF1 |DCN1 |DID4 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Imhof I, et al. (2000) Phosphatidylethanolamine is the donor of the phosphorylethanolamine linked to the alpha1,4-linked mannose of yeast GPI structures. Glycobiology 10(12):1271-5
       |CPT1 |GPI10
Reviews
Carman GM and Henry SA (1999) Phospholipid biosynthesis in the yeast Saccharomyces cerevisiae and interrelationship with other metabolic processes. Prog Lipid Res 38(5-6):361-99
     |LPP1
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Henneberry AL and McMaster CR (1999) Cloning and expression of a human choline/ethanolaminephosphotransferase: synthesis of phosphatidylcholine and phosphatidylethanolamine. Biochem J 339 ( Pt 2)():291-8
       |CPT1
Reviews
Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510
       |ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |ERG1 |MORE
Function/Process
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Williams JG and McMaster CR (1998) Scanning alanine mutagenesis of the CDP-alcohol phosphotransferase motif of Saccharomyces cerevisiae cholinephosphotransferase. J Biol Chem 273(22):13482-7
       |CHO1 |CPT1 |PIS1
Reviews
Carman GM and Zeimetz GM (1996) Regulation of phospholipid biosynthesis in the yeast Saccharomyces cerevisiae. J Biol Chem 271(23):13293-6
       |CDS1 |CHO1 |CKI1 |CPT1
Function/Process
Regulatory Role
Griac P, et al. (1996) The role of phosphatidylcholine biosynthesis in the regulation of the INO1 gene of yeast. J Biol Chem 271(41):25692-8
       |CHO2 |CPT1 |INO1 |OPI3
Other Features
Protein Physical Properties
Regulation of
Strains/Constructs
Techniques and Reagents
McMaster CR, et al. (1996) Phospholipid and cation activation of chimaeric choline/ethanolamine phosphotransferases. Biochem J 313 ( Pt 3)():729-35
       |CPT1
Mapping
Xu L, et al. (1995) NDT80, a meiosis-specific gene required for exit from pachytene in Saccharomyces cerevisiae. Mol Cell Biol 15(12):6572-81
       |CDC28 |NDT80 |RAD50 |SPO11 |VPS1
Non-Fungal Related Genes/Proteins
Dewey RE, et al. (1994) The AAPT1 gene of soybean complements a cholinephosphotransferase-deficient mutant of yeast. Plant Cell 6(10):1495-507
         |CPT1
Genetic Interactions
Other Features
Strains/Constructs
Hjelmstad RH, et al. (1994) Chimeric enzymes. Structure-function analysis of segments of sn-1,2-diacylglycerol choline- and ethanolaminephosphotransferases. J Biol Chem 269(33):20995-1002
     |CPT1
Mutants/Phenotypes
Other Features
Strains/Constructs
McMaster CR and Bell RM (1994) Phosphatidylcholine biosynthesis in Saccharomyces cerevisiae. Regulatory insights from studies employing null and chimeric sn-1,2-diacylglycerol choline- and ethanolaminephosphotransferases. J Biol Chem 269(45):28010-6
     |CPT1
Mutants/Phenotypes
McMaster CR and Bell RM (1994) Phosphatidylcholine biosynthesis via the CDP-choline pathway in Saccharomyces cerevisiae. Multiple mechanisms of regulation. J Biol Chem 269(20):14776-83
     |CPT1
Mutants/Phenotypes
RNA Levels and Processing
Regulation of
Morash SC, et al. (1994) Studies employing Saccharomyces cerevisiae cpt1 and ept1 null mutants implicate the CPT1 gene in coordinate regulation of phospholipid biosynthesis. J Biol Chem 269(46):28769-76
     |CPT1
Mutants/Phenotypes
Menon AK and Stevens VL (1992) Phosphatidylethanolamine is the donor of the ethanolamine residue linking a glycosylphosphatidylinositol anchor to protein. J Biol Chem 267(22):15277-80
     |CPT1
DNA/RNA Sequence Features
Fungal Related Genes/Proteins
Genetic Interactions
Protein Physical Properties
Protein Sequence Features
Protein/Nucleic Acid Structure
Strains/Constructs
Techniques and Reagents
Hjelmstad RH and Bell RM (1991) sn-1,2-diacylglycerol choline- and ethanolaminephosphotransferases in Saccharomyces cerevisiae. Mixed micellar analysis of the CPT1 and EPT1 gene products. J Biol Chem 266(7):4357-65
     |CPT1
DNA/RNA Sequence Features
Function/Process
Fungal Related Genes/Proteins
Hjelmstad RH and Bell RM (1991) sn-1,2-diacylglycerol choline- and ethanolaminephosphotransferases in Saccharomyces cerevisiae. Nucleotide sequence of the EPT1 gene and comparison of the CPT1 and EPT1 gene products. J Biol Chem 266(8):5094-103
     |CPT1
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Hjelmstad RH and Bell RM (1988) The sn-1,2-diacylglycerol ethanolaminephosphotransferase activity of Saccharomyces cerevisiae. Isolation of mutants and cloning of the EPT1 gene. J Biol Chem 263(36):19748-57
     |CPT1

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.