BIG1/YHR101C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVIII: 315971 to 314877
intron: 315861 - 315775
CDS: 315971 - 315862, 315774 - 314877

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

BIG1 YHR101C ORF, Verified S000001143

Description
Integral membrane protein of the endoplasmic reticulum, required for normal content of cell wall beta-1,6-glucan

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
hydrogen ion transporting ATP synthase activity, rotational mechanism DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR008388
Assigned on 2009-11-20 UniProtKB
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-08-07 SGD
proton-transporting ATPase activity, rotational mechanism DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR008388
Assigned on 2009-11-20 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ATP synthesis coupled proton transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR008388
Assigned on 2009-11-20 UniProtKB
cellular cell wall organization GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0961
Assigned on 2008-02-14 UniProtKB
fungal-type cell wall biogenesis Azuma M, et al. (2002) Saccharomyces cerevisiae Big1p, a putative endoplasmic reticulum membrane protein required for normal levels of cell wall beta-1,6-glucan. Yeast 19(9):783-93
       IMP : Inferred from Mutant Phenotype
IGI : Inferred from Genetic Interaction
Assigned on 2002-08-07 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to endoplasmic reticulum membrane Azuma M, et al. (2002) Saccharomyces cerevisiae Big1p, a putative endoplasmic reticulum membrane protein required for normal levels of cell wall beta-1,6-glucan. Yeast 19(9):783-93
       IDA : Inferred from Direct Assay
Assigned on 2005-06-23 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9905
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
proton-transporting V-type ATPase, V1 domain DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR008388
Assigned on 2009-11-20 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forBIG1/YHR101C for BIG1
1) Azuma M, et al. (2002) Saccharomyces cerevisiae Big1p, a putative endoplasmic reticulum membrane protein required for normal levels of cell wall beta-1,6-glucan. Yeast 19(9):783-93

2) Bickle M, et al. (1998) Cell wall integrity modulates RHO1 activity via the exchange factor ROM2. EMBO J 17(8):2235-45

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BIG1/YHR101C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BIG1/YHR101C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MQTVLKY

C-term KPSQQVS

Length(aa) 335

MW(Da) 39,068

pI 5.04

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.043

Codon Adaptation Index 0.128

Frequency of Optimal Codons 0.450

Hydropathicity of Protein -0.307

Aromaticity Score 0.116

10 20 30 40 50 | | | | | MQTVLKYLLLIMCGSFCASEELQNQTNVPAIFFSYKLTPGILKYQEDYDR AVTLPRDTFIEAAEKFLGVCNADTYVFINQPGLRKLDFLEFETEFVSLQR YIRRSSTAIKFEKVDLLPQDLYYDLAEFVKEYCNVDQVLNLRGNNTEDFQ PFIDSEKRVIIIEYPKLPEDTNERKEAFRHYDKYLRTILAQIPSPEQNVI YTSLNPGTTLAHESIIPIQIFPDIFDIKSRVGEVEQNNRVLDVPRLSFND YTPRFSEPPSEYVSIFDSQLIENNRGLLQLIFTILVGYILIQFFFTKKTI VDEKITNKKDNVKQTSPQLLKKVQEIQKKPSQQVS*

Protein Structures from PDB: proteins of known structure with sequence similarity to BIG1/YHR101C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
BIG1 SGD (2007) Information without a citation in SGD

Standard Name	Reference
BIG1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YHR101C SGD Systematic Sequence

856501 NCBI: Gene ID

NP_011969.1 NCBI: RefSeq protein version ID

NP_011969.1 NCBI: RefSeq protein version ID

6321893 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YHR101C	SGD Systematic Sequence
856501	NCBI: Gene ID
NP_011969.1	NCBI: RefSeq protein version ID
NP_011969.1	NCBI: RefSeq protein version ID
6321893	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
10 curated references; 0 references not yet curated
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Protein Physical Properties
White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36
         |ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |COS8 |MORE
Reviews
Lesage G and Bussey H (2006) Cell wall assembly in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(2):317-43
       |ANP1 |BGL2 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |CHS6 |CHS7 |CNE1 |CRH1 |CRR1 |CTS1 |CTS2 |MORE
Cross-species Expression
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Umeyama T, et al. (2006) Deletion of the CaBIG1 gene reduces beta-1,6-glucan synthesis, filamentation, adhesion, and virulence in Candida albicans. Infect Immun 74(4):2373-81

Function/Process
Genetic Interactions
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Machi K, et al. (2004) Rot1p of Saccharomyces cerevisiae is a putative membrane protein required for normal levels of the cell wall 1,6-beta-glucan. Microbiology 150(Pt 10):3163-73
       |FLO1 |KRE5 |ROT1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Tomishige N, et al. (2003) Mutations that are synthetically lethal with a gas1Delta allele cause defects in the cell wall of Saccharomyces cerevisiae. Mol Genet Genomics 269(4):562-73
     |CSG2 |GAS1 |IPT1 |KEX2 |KRE6 |MKC7 |SLG1 |YPS1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Azuma M, et al. (2002) Saccharomyces cerevisiae Big1p, a putative endoplasmic reticulum membrane protein required for normal levels of cell wall beta-1,6-glucan. Yeast 19(9):783-93
       |KRE5
DNA/RNA Sequence Features
Davis CA, et al. (2000) Test of intron predictions reveals novel splice sites, alternatively spliced mRNAs and new introns in meiotically regulated genes of yeast. Nucleic Acids Res 28(8):1700-6
       |AIM11 |AMA1 |AML1 |APE2 |APS3 |ARP9 |ASC1 |BET1 |BOS1 |CDC21 |COF1 |DCN1 |DID4 |DTD1 |MORE
DNA/RNA Sequence Features
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Bickle M, et al. (1998) Cell wall integrity modulates RHO1 activity via the exchange factor ROM2. EMBO J 17(8):2235-45
       |CWH41 |FKS1 |GAS1 |RHO1 |ROM2 |ROT1 |ROT2 |SAC7 |TOR2

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.