- Site Map |
- Search Options |
- Help |
- Home |
| 
ERG11/YHR007C Single Page Format |
|
Contents
- Names and Identifiers
- GO Annotations
- Pathways
- Summary Paragraph
- Mutant Phenotypes
- Interactions
- Homologs
- Protein Info (physical properties, transcript info)
- PDB Homologs (protein structure info)
- Motifs
- Genome-wide Expression
(and other large-scale analyses)- Locus History (misc. notes)
- Sequence Retrieval and Analysis
- Map and Displays
- Localization
- Community Annotation
- Literature Guide
Sequence Coordinates
ChrVIII: 121678 to 120086
CDS: 121678 - 120086
Genetic position: 12 cMClick on map for expanded view
SGD ORF map GBrowse SGD Locus Page
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Standard Name | Systematic Name | Alias | Feature Type | SGDID | ||||
| ERG11 | YHR007C | CYP51 | ORF, Verified | S000001049 | ||||
| Description | ||||||||
| Lanosterol 14-alpha-demethylase, catalyzes the C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in the ergosterol biosynthesis pathway; member of the cytochrome P450 family | ||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| ergosterol biosynthesis | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
| |||||||
|---|---|---|---|---|---|---|---|
| Phenotype page for ERG11/YHR007C | |||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Interaction page for ERG11/YHR007C | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 10 20 30 40 50
| | | | |
MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIIIPFIYNIVWQLLYS
LRKDRPPLVFYWIPWVGSAVVYGMKPYEFFEECQKKYGDIFSFVLLGRVM
TVYLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLMEQ
KKFVKGALTKEAFKSYVPLIAEEVYKYFRDSKNFRLNERTTGTIDVMVTQ
PEMTIFTASRSLLGKEMRAKLDTDFAYLYSDLDKGFTPINFVFPNLPLEH
YRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMT
DQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDG
GKKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVI
PAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFG
AISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKT
VPPPDFTSMVTLPTGPAKIIWEKRNPEQKI*
| ||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||
|---|---|---|---|---|---|
| You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses. | |||||
| ||||
|---|---|---|---|---|
| Nomenclature History |
|---|
| Standard Name | Reference |
|---|---|
| ERG11 | Karst F and Lacroute F (1977) Ertosterol biosynthesis in Saccharomyces cerevisiae: mutants deficient in the early steps of the pathway. Mol Gen Genet 154(3):269-77  |
| Mapping Notes |
| Date | Note |
|---|---|
| 1992-10-01 | Edition 11: erg11 is adjacent to sod2 based on DNA sequence analysisMortimer RK, et al. (1992) Genetic and physical maps of Saccharomyces cerevisiae, Edition 11. Yeast 8(10):817-902  |
| |||||
|---|---|---|---|---|---|
| Sequence Type | Output Format | ||||
| Genomic DNA | GCG | FASTA | NoHeader | ||||
| Genomic DNA with 1 kb up and downstream | GCG | FASTA | NoHeader | ||||
| DNA coding sequence (without introns, without flanking regions) | GCG | FASTA | NoHeader | ||||
| Protein Translation of ORF | GCG | FASTA | NoHeader | ||||
| 6-Frame Translation(with Restriction Map) | GCG | ||||
| Restriction Fragment Sizes | GCG | ||||
| Sequence from other databases | |
|---|---|
| Sequence ID | Source |
| YHR007C | SGD Systematic Sequence |
| 856398 | NCBI: Gene ID |
| NP_011871.1 | NCBI: RefSeq protein version ID |
| NP_011871.1 | NCBI: RefSeq protein version ID |
| 6321795 | NCBI: NCBI protein GI |
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Physical, Genetic Maps: | Chromosomal Feature Map | GBrowse | Combined Physical and Genetic Map | Genetic Distance vs. Physical Distance Ratios | ||||
| Similarity Viewers: | Synteny Viewer | Genomic Stripe View | SAGE Results Map | |||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No community annotation available. | |||||||||
| ||||||
|---|---|---|---|---|---|---|
| Topics | Reference | Other Genes Addressed | 156 curated references; 0 references not yet curated | |||
| Alias Infection and Antifungals Protein Physical Properties Strains/Constructs | Kitahama Y, et al. (2009) The Construction and Characterization of Self-Sufficient Lanosterol 14-Demethylase Fusion Proteins Consisting of Yeast CYP51 and Its Reductase. Biol Pharm Bull 32(4):558-63  | |NCP1 | ||||
| Cross-species Expression Fungal Related Genes/Proteins | Lamping E, et al. (2009) Abc1p Is a Multidrug Efflux Transporter That Tips the Balance in Favor of Innate Azole Resistance in Candida krusei. Antimicrob Agents Chemother 53(2):354-369 | |PDR5 | ||||
| Regulation of Transcription | Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461 | |AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE | ||||
| Substrates/Ligands/Cofactors | Smith AM, et al. (2009) Quantitative phenotyping via deep barcode sequencing. Genome Res 19(10):1836-42 | |ALG7 |ERG24 |SSL2 | ||||
| Fungal Related Genes/Proteins | Vandeputte P, et al. (2009) Hypersusceptibility to azole antifungals in a clinical isolate of Candida glabrata with reduced aerobic growth. Antimicrob Agents Chemother 53(7):3034-41 | |PDR1 | ||||
| RNA Levels and Processing | Verbelen PJ, et al. (2009) The influence of yeast oxygenation prior to brewery fermentation on yeast metabolism and the oxidative stress response. FEMS Yeast Res 9(2):226-39 | |ACT1 |ARE2 |COX15 |CTA1 |CTT1 |CYC1 |CYC7 |ERG1 |HAP1 |HSP12 |OLE1 |PAU5 |QCR9 |ROX1 |MORE | ||||
| Transcription | Zara G, et al. (2009) Oxygen is required to restore flor strain viability and lipid biosynthesis under fermentative conditions. FEMS Yeast Res 9(2):217-25 | |ACC1 |ACS1 |ACS2 |ARE1 |ARE2 |ERG1 |OLE1 | ||||
| Mutants/Phenotypes Strains/Constructs | Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8 | |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Hoon S, et al. (2008) An integrated platform of genomic assays reveals small-molecule bioactivities. Nat Chem Biol 4(8):498-506 | |BCK1 |CRG1 |DFR1 |EAP1 |FPR1 |GLC7 |PTA1 |RLM1 |SEC14 |SLT2 |SWD2 |TOR2 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Paluszynski JP, et al. (2008) Genetic prerequisites for additive or synergistic actions of 5-fluorocytosine and fluconazole in baker's yeast. Microbiology 154(Pt 10):3154-64 | |ERG3 |FCY1 |FCY2 |FUR1 |URA10 |URA5 | ||||
| Cross-species Expression Non-Fungal Related Genes/Proteins | Parker JE, et al. (2008) Differential azole antifungal efficacies contrasted using a Saccharomyces cerevisiae strain humanized for sterol 14 alpha-demethylase at the homologous locus. Antimicrob Agents Chemother 52(10):3597-603 | |||||
| Alias Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs | Warrilow A, et al. (2008) Expression and Characterization of CYP51, the Ancient Sterol 14-demethylase Activity for Cytochromes P450 (CYP), in the White-Rot Fungus Phanerochaete chrysosporium. Lipids 43(12):1143-53 | |||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Wu TK, et al. (2008) Protein plasticity: a single amino acid substitution in the Saccharomyces cerevisiae oxidosqualene-lanosterol cyclase generates protosta-13(17),24-dien-3beta-ol, a rearrangement product. Org Lett 10(12):2529-32 | |ERG7 |HEM1 | ||||
| Alias Cross-species Expression Fungal Related Genes/Proteins | Chen SH, et al. (2007) Identification of Y118 Amino Acid Residue in Candida albicans Sterol 14alpha-Demethylase Associated with the Enzyme Activity and Selective Antifungal Activity of Azole Analogues. Biol Pharm Bull 30(7):1246-53 | |||||
| Genetic Interactions | Craven RJ, et al. (2007) Regulation of iron homeostasis mediated by the heme-binding protein Dap1 (damage resistance protein 1) via the P450 protein Erg11/Cyp51. J Biol Chem 282(50):36543-51 | |DAP1 |FET3 |HEM1 |HEM2 | ||||
| Substrates/Ligands/Cofactors | Daicho K, et al. (2007) The ergosterol biosynthesis inhibitor zaragozic acid promotes vacuolar degradation of the tryptophan permease Tat2p in yeast. Biochim Biophys Acta 1768(7):1681-1690 | |ERG1 |ERG6 |ERG9 |PEP12 |PEP4 |RSP5 |TAT2 |VPS1 |VPS27 |VPS45 | ||||
| Regulation of Transcription | Hickman MJ and Winston F (2007) Heme Levels Switch the Function of Hap1 of Saccharomyces cerevisiae between Transcriptional Activator and Transcriptional Repressor. Mol Cell Biol 27(21):7414-24  | |CYC1 |CYC8 |ERG2 |ERG5 |HAP1 |HSC82 |HSP82 |SSA1 |TUP1 | ||||
| Fungal Related Genes/Proteins | Hu W, et al. (2007) Essential gene identification and drug target prioritization in Aspergillus fumigatus. PLoS Pathog 3(3):e24 | |ALG6 |AUR1 |BRX1 |CDS1 |ERG10 |ERG12 |ESF1 |FKS1 |GCD6 |GFA1 |GUS1 |HEM15 |HIS4 |IPP1 |MORE | ||||
| Reviews | Schulz TA and Prinz WA (2007) Sterol transport in yeast and the oxysterol binding protein homologue (OSH) family. Biochim Biophys Acta 1771(6):769-80 | |AUS1 |CAT5 |DAN1 |ERG1 |ERG27 |ERG3 |ERG5 |ERG6 |ERG7 |HES1 |KES1 |MGM101 |NCR1 |NPC2 |MORE | ||||
| Protein Processing/Modification/Regulation RNA Levels and Processing Techniques and Reagents | Thompson AM, et al. (2007) Measurement of the heme affinity for yeast dap1p, and its importance in cellular function. Biochemistry 46(50):14629-37 | |DAP1 | ||||
| Non-Fungal Related Genes/Proteins Regulation of | Tu BP and McKnight SL (2007) The yeast metabolic cycle: insights into the life of a eukaryotic cell. Cold Spring Harb Symp Quant Biol 72:339-43 | |CDC1 |CTA1 |DBP1 |HSP26 |INO1 |MCH5 |MRS4 |SAD1 |SEC18 |SLM3 |SWI3 |TMA29 |ULA1 |YAH1 |MORE | ||||
| Regulation of | de Groot MJ, et al. (2007) Quantitative proteomics and transcriptomics of anaerobic and aerobic yeast cultures reveals post-transcriptional regulation of key cellular processes. Microbiology 153(Pt 11):3864-3878 | |ACO1 |ACO2 |ACS1 |ACS2 |ADE13 |ADE17 |ADE2 |ADE3 |ADE4 |ADE5,7 |ADE6 |ADH1 |ADH2 |ADH5 |MORE | ||||
| Infection and Antifungals Reviews | Carrillo-Munoz AJ, et al. (2006) Antifungal agents: mode of action in yeast cells. Rev Esp Quimioter 19(2):130-9 | |ERG2 |ERG24 | ||||
| Cross-species Expression Infection and Antifungals Non-Fungal Related Genes/Proteins | Chau AS, et al. (2006) Molecular Basis for Enhanced Activity of Posaconazole against Absidia corymbifera and Rhizopus oryzae. Antimicrob Agents Chemother 50(11):3917-9 | |||||
| Fungal Related Genes/Proteins | Insenser M, et al. (2006) Proteomic analysis of detergent-resistant membranes from Candida albicans. Proteomics 6 Suppl 1:S74-81 | |ATP2 |ECM33 |EFT1 |EFT2 |HSC82 |HXT6 |KRE2 |KTR1 |PET2 |PMA1 |PMT2 |POR1 |RPL16A |RPL4B |MORE | ||||
| Genetic Interactions | Warringer J and Blomberg A (2006) Involvement of yeast YOL151W/GRE2 in ergosterol metabolism. Yeast 23(5):389-98 | |BGL2 |ENO1 |ERG10 |ERG2 |ERG24 |ERG6 |GRE2 |HMG1 |HMG2 |HXK1 |MVD1 |RNR4 |TDH1 | ||||
| Fungal Related Genes/Proteins | Akins RA (2005) An update on antifungal targets and mechanisms of resistance in Candida albicans. Med Mycol 43(4):285-318 | |ERG3 | ||||
| Reviews | Aoyama Y (2005) Recent progress in the CYP51 research focusing on its unique evolutionary and functional characteristics as a diversozyme P450. Front Biosci 10:1546-57 | |||||
| Mutants/Phenotypes RNA Levels and Processing Techniques and Reagents | Buurman ET, et al. (2005) Utilization of target-specific, hypersensitive strains of Saccharomyces cerevisiae to determine the mode of action of antifungal compounds. Antimicrob Agents Chemother 49(6):2558-60 | |AUR1 |ERG1 |ERG7 |ERG8 |ERG9 |LCB1 |PKC1 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52  | |ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE | ||||
| Fungal Related Genes/Proteins | Ferreira ME, et al. (2005) The ergosterol biosynthesis pathway, transporter genes, and azole resistance in Aspergillus fumigatus. Med Mycol 43 Suppl 1:S313-9 | |ERG3 | ||||
| Mutants/Phenotypes | Flaherty P, et al. (2005) A latent variable model for chemogenomic profiling. Bioinformatics 21(15):3286-93 | |ARC18 |CDC21 |DFR1 |DIA4 |DIS3 |ERG13 |ERG24 |FKS1 |FOL1 |FOL2 |GCD2 |HMG1 |LCB1 |MAL11 |MORE | ||||
| RNA Levels and Processing Regulation of | Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91 | |AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Mallory JC, et al. (2005) Dap1p, a heme-binding protein that regulates the cytochrome P450 protein Erg11p/Cyp51p in Saccharomyces cerevisiae. Mol Cell Biol 25(5):1669-79 | |DAP1 | ||||
| Protein-protein Interactions | Miller JP, et al. (2005) Large-scale identification of yeast integral membrane protein interactions. Proc Natl Acad Sci U S A 102(34):12123-8 | |ARV1 |EMP24 |EMP46 |EMP47 |ERD1 |ERD2 |ERP5 |ERV29 |ERV41 |MST27 |PHO84 |PHO88 |SEC61 |SHR3 |MORE | ||||
| Protein-protein Interactions Techniques and Reagents | Mo C and Bard M (2005) A systematic study of yeast sterol biosynthetic protein-protein interactions using the split-ubiquitin system. Biochim Biophys Acta 1737(2-3):152-60 | |ERG1 |ERG2 |ERG24 |ERG25 |ERG26 |ERG27 |ERG28 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9 | ||||
| Protein-protein Interactions | Mo C and Bard M (2005) Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex. J Lipid Res 46(9):1991-8 | |ERG1 |ERG25 |ERG26 |ERG27 |ERG28 |ERG6 | ||||
| Cellular Location Genetic Interactions Mutants/Phenotypes Strains/Constructs | Ott RG, et al. (2005) Flux of sterol intermediates in a yeast strain deleted of the lanosterol C-14 demethylase Erg11p. Biochim Biophys Acta 1735(2):111-8 | |ERG3 |ERG6 |ERG7 | ||||
| RNA Levels and Processing Regulation of Transcription | Puig S, et al. (2005) Coordinated remodeling of cellular metabolism during iron deficiency through targeted mRNA degradation. Cell 120(1):99-110 | |ACO1 |AFT1 |AFT2 |CCC1 |CCP1 |CIR2 |CIT1 |CIT3 |COQ6 |COR1 |COX4 |COX6 |COX8 |COX9 |MORE | ||||
| Reviews | Waterman MR and Lepesheva GI (2005) Sterol 14 alpha-demethylase, an abundant and essential mixed-function oxidase. Biochem Biophys Res Commun 338(1):418-22 | |||||
| Genetic Interactions Mutants/Phenotypes | Giaever G, et al. (2004) Chemogenomic profiling: identifying the functional interactions of small molecules in yeast. Proc Natl Acad Sci U S A 101(3):793-8 | |DFR1 |ERG13 |ERG2 |ERG24 |FOL1 |FOL2 |HMG1 |HMG2 |MAL11 |MUS81 |NEO1 |PSO2 |RAD1 |RAD10 |MORE | ||||
| Techniques and Reagents | Hartman JL 4th and Tippery NP (2004) Systematic quantification of gene interactions by phenotypic array analysis. Genome Biol 5(7):R49 | |PAC10 |RAD52 |TOP3 |VPS28 | ||||
| RNA Levels and Processing Regulation of | Jones DL, et al. (2004) Genome-Wide Analysis of the Effects of Heat Shock on a Saccharomyces cerevisiae Mutant With a Constitutively Activated cAMP-Dependent Pathway. Comp Funct Genomics 5(5):419-31 | |BTN2 |COX6 |DCS1 |ENO1 |ERG10 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG26 |ERG27 |ERG3 |ERG6 |MORE | ||||
| RNA Levels and Processing Techniques and Reagents | Krantz M, et al. (2004) Anaerobicity prepares Saccharomyces cerevisiae cells for faster adaptation to osmotic shock. Eukaryot Cell 3(6):1381-90 | |ALD2 |ALD3 |ALD4 |ALD6 |CTT1 |ERG1 |ERG10 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |ERG26 |MORE | ||||
| Other Features | Mo C, et al. (2004) The ERG28-encoded protein, Erg28p, interacts with both the sterol C-4 demethylation enzyme complex as well as the late biosynthetic protein, the C-24 sterol methyltransferase (Erg6p). Biochim Biophys Acta 1686(1-2):30-6 | |ERG28 |ERG3 |ERG6 |ERG7 | ||||
| Genetic Interactions Strains/Constructs | Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9 | |ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CAX4 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |MORE | ||||
| Cross-species Expression Strains/Constructs | Revankar SG, et al. (2004) Cloning and characterization of the lanosterol 14alpha-demethylase (ERG11) gene in Cryptococcus neoformans. Biochem Biophys Res Commun 324(2):719-28 | |||||
| Fungal Related Genes/Proteins | Silver PM, et al. (2004) Role of Candida albicans transcription factor Upc2p in drug resistance and sterol metabolism. Eukaryot Cell 3(6):1391-7 | |ECM22 |ERG2 |UPC2 | ||||
| Regulation of Transcription | Agarwal AK, et al. (2003) Genome-wide expression profiling of the response to polyene, pyrimidine, azole, and echinocandin antifungal agents in Saccharomyces cerevisiae. J Biol Chem 278(37):34998-5015 | |AGA1 |AMS1 |ATF2 |AUS1 |BAG7 |BAP2 |BAP3 |CRH1 |CTR1 |CWP1 |CYB5 |DAN1 |DAN4 |ELO1 |MORE | ||||
| Function/Process Regulation of | Anderson JB, et al. (2003) Mode of selection and experimental evolution of antifungal drug resistance in Saccharomyces cerevisiae. Genetics 163(4):1287-98 | |CKA2 |ERG28 |ERG3 |ERG6 |LCL1 |PDR1 |PDR5 |RTC2 |SCS2 |SML1 |SNQ2 |SWH1 |YGR283C |YLR407W |MORE | ||||
| Cross-species Expression Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Buckner FS, et al. (2003) Cloning and analysis of Trypanosoma cruzi lanosterol 14alpha-demethylase. Mol Biochem Parasitol 132(2):75-81 | |||||
| Cross-species Expression Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs | Morales IJ, et al. (2003) Characterization of a lanosterol 14 alpha-demethylase from Pneumocystis carinii. Am J Respir Cell Mol Biol 29(2):232-8 | |||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Veen M, et al. (2003) Combined overexpression of genes of the ergosterol biosynthetic pathway leads to accumulation of sterols in Saccharomyces cerevisiae. FEMS Yeast Res 4(1):87-95 | |ERG1 |HMG1 | ||||
| Function/Process | Edlind T, et al. (2002) Antifungal activity in Saccharomyces cerevisiae is modulated by calcium signalling. Mol Microbiol 46(1):257-68 | |CRZ1 |GSC2 |PMR1 | ||||
| Regulation of | Henry KW, et al. (2002) ROX1 and ERG regulation in Saccharomyces cerevisiae: implications for antifungal susceptibility. Eukaryot Cell 1(6):1041-4 | |ROX1 | ||||
| DNA/RNA Sequence Features Regulation of Transcription | Iyer VR, et al. (2001) Genomic binding sites of the yeast cell-cycle transcription factors SBF and MBF. Nature 409(6819):533-8 | |ABF1 |APN1 |BBP1 |BUD9 |CAP1 |CDC21 |CDC45 |CDC7 |CLA4 |CLB1 |CLB2 |CLB6 |CLD1 |CLN1 |MORE | ||||
| Fungal Related Genes/Proteins | Mellado E, et al. (2001) Identification of two different 14-alpha sterol demethylase-related genes (cyp51A and cyp51B) in Aspergillus fumigatus and other Aspergillus species. J Clin Microbiol 39(7):2431-8 | |||||
| Fungal Related Genes/Proteins | Nakayama H, et al. (2001) In vitro and in vivo effects of 14alpha-demethylase (ERG11) depletion in Candida glabrata. Antimicrob Agents Chemother 45(11):3037-45 | |||||
| Fungal Related Genes/Proteins | Osherov N, et al. (2001) Resistance to itraconazole in Aspergillus nidulans and Aspergillus fumigatus is conferred by extra copies of the A. nidulans P-450 14alpha-demethylase gene, pdmA. J Antimicrob Chemother 48(1):75-81 | |||||
| Cellular Location Mutants/Phenotypes Protein Processing/Modification/Regulation Strains/Constructs | Homma K, et al. (2000) Evidence for recycling of cytochrome P450 sterol 14-demethylase from the cis-Golgi compartment to the endoplasmic reticulum (ER) upon saturation of the ER-retention mechanism. J Biochem 127(5):747-54 | |||||
| Fungal Related Genes/Proteins | Kakeya H, et al. (2000) Genetic analysis of azole resistance in the Darlington strain of Candida albicans. Antimicrob Agents Chemother 44(11):2985-90 | |||||
| Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins | Lamb DC, et al. (2000) Differential inhibition of human CYP3A4 and Candida albicans CYP51 with azole antifungal agents. Chem Biol Interact 125(3):165-75 | |||||
| Mutants/Phenotypes Protein Processing/Modification/Regulation Regulation of | Launhardt H and Munder T (2000) Post-translational regulation of Saccharomyces cerevisiae proteins tagged with the hormone-binding domains of mammalian nuclear receptors. Mol Gen Genet 264(3):317-24 | |ERG3 |RPN5 |SCM3 | ||||
| Other Features Techniques and Reagents | Posteraro B, et al. (2000) Reverse cross blot hybridization assay for rapid detection of PCR-amplified DNA from candida species, Cryptococcus neoformans, and Saccharomyces cerevisiae in clinical samples. J Clin Microbiol 38(4):1609-14 | |||||
| Reviews | Sturley SL (2000) Conservation of eukaryotic sterol homeostasis: new insights from studies in budding yeast. Biochim Biophys Acta 1529(1-3):155-63 | |ARE1 |ARE2 |ARH1 |ARV1 |ECM22 |ERG10 |ERG6 |ERG9 |HMG1 |HMG2 |HMS1 |LRO1 |NCR1 |ROX1 |MORE | ||||
| Non-Fungal Related Genes/Proteins | Cabello-Hurtado F, et al. (1999) Optimized expression and catalytic properties of a wheat obtusifoliol 14alpha-demethylase (CYP51) expressed in yeast. Complementation of erg11Delta yeast mutants by plant CYP51. Eur J Biochem 262(2):435-46 | |||||
| Genomic expression study Regulation of | Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60 | |ARE1 |ARE2 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG1 |MORE | ||||
| Cross-species Expression Fungal Related Genes/Proteins | Favre B, et al. (1999) Multiple amino acid substitutions in lanosterol 14alpha-demethylase contribute to azole resistance in Candida albicans. Microbiology 145 ( Pt 10):2715-25 | |||||
| Mutants/Phenotypes Strains/Constructs | Giaever G, et al. (1999) Genomic profiling of drug sensitivities via induced haploinsufficiency. Nat Genet 21(3):278-83 | |ALG7 |HIS3 |RNR2 |RPL20A |RSN1 |TUB1 |TUB2 |YMR007W | ||||
| Fungal Related Genes/Proteins | Kelly SL, et al. (1999) Y132H substitution in Candida albicans sterol 14alpha-demethylase confers fluconazole resistance by preventing binding to haem. FEMS Microbiol Lett 180(2):171-5 | |||||
| Fungal Related Genes/Proteins Mutants/Phenotypes Other Features Strains/Constructs | Kontoyiannis DP, et al. (1999) Overexpression of Erg11p by the regulatable GAL1 promoter confers fluconazole resistance in Saccharomyces cerevisiae. Antimicrob Agents Chemother 43(11):2798-800 | |||||
| Function/Process Techniques and Reagents | Lamb DC, et al. (1999) Biodiversity of the P450 catalytic cycle: yeast cytochrome b5/NADH cytochrome b5 reductase complex efficiently drives the entire sterol 14-demethylation (CYP51) reaction. FEBS Lett 462(3):283-8 | |CYB5 |MCR1 |NCP1 | ||||
| Cross-species Expression Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins | Lamb DC, et al. (1999) Characteristics of the heterologously expressed human lanosterol 14alpha-demethylase (other names: P45014DM, CYP51, P45051) and inhibition of the purified human and Candida albicans CYP51 with azole antifungal agents. Yeast 15(9):755-63 | |||||
| Fungal Related Genes/Proteins | Lamb DC, et al. (1999) Generation of a complete, soluble, and catalytically active sterol 14 alpha-demethylase-reductase complex. Biochemistry 38(27):8733-8 | |NCP1 | ||||
| Fungal Related Genes/Proteins | Lamb DC, et al. (1999) Purification, reconstitution, and inhibition of cytochrome P-450 sterol delta22-desaturase from the pathogenic fungus Candida glabrata. Antimicrob Agents Chemother 43(7):1725-8 | |ERG5 | ||||
| Function/Process Non-Fungal Related Genes/Proteins Other Features Protein Sequence Features Protein/Nucleic Acid Structure | Lewis DF, et al. (1999) Molecular modelling of lanosterol 14 alpha-demethylase (CYP51) from Saccharomyces cerevisiae via homology with CYP102, a unique bacterial cytochrome P450 isoform: quantitative structure-activity relationships (QSARs) within two related series of antifungal azole derivatives. J Enzyme Inhib 14(3):175-92 | |||||
| Fungal Related Genes/Proteins | Marichal P, et al. (1999) Contribution of mutations in the cytochrome P450 14alpha-demethylase (Erg11p, Cyp51p) to azole resistance in Candida albicans. Microbiology 145 ( Pt 10):2701-13 | |||||
| Reviews | Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510 | |ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Launhardt H, et al. (1998) Drug-induced phenotypes provide a tool for the functional analysis of yeast genes. Yeast 14(10):935-42 | |COX3 |CRH1 |ICT1 |RPL27A |TPP1 |YAR068W |YNL011C | ||||
| Cross-species Expression Fungal Related Genes/Proteins | Sanglard D, et al. (1998) Amino acid substitutions in the cytochrome P-450 lanosterol 14alpha-demethylase (CYP51A1) from azole-resistant Candida albicans clinical isolates contribute to resistance to azole antifungal agents. Antimicrob Agents Chemother 42(2):241-53 | |||||
| Function/Process Genetic Interactions Other Features Strains/Constructs | Venkateswarlu K, et al. (1998) NADPH cytochrome P-450 oxidoreductase and susceptibility to ketoconazole. Antimicrob Agents Chemother 42(7):1756-61 | |ERG5 |NCP1 | ||||
| Alias Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Substrates/Ligands/Cofactors | Venkateswarlu K, et al. (1998) The N-terminal membrane domain of yeast NADPH-cytochrome P450 (CYP) oxidoreductase is not required for catalytic activity in sterol biosynthesis or in reconstitution of CYP activity. J Biol Chem 273(8):4492-6 | |ERG5 |NCP1 | ||||
| Reviews | van den Brink HM, et al. (1998) Cytochrome P450 enzyme systems in fungi. Fungal Genet Biol 23(1):1-17 | |DIT2 |ERG5 |NCP1 | ||||
| Alias Non-Fungal Related Genes/Proteins | Cabello-Hurtado F, et al. (1997) Cloning and functional expression in yeast of a cDNA coding for an obtusifoliol 14alpha-demethylase (CYP51) in wheat. Biochem Biophys Res Commun 230(2):381-5 | |||||
| Genetic Interactions | Gachotte D, et al. (1997) A yeast sterol auxotroph (erg25) is rescued by addition of azole antifungals and reduced levels of heme. Proc Natl Acad Sci U S A 94(21):11173-8 | |ERG25 |ERG6 |HEM2 |HEM4 | ||||
| Fungal Related Genes/Proteins | Kelly SL, et al. (1997) Characterization of Saccharomyces cerevisiae CYP61, sterol delta22-desaturase, and inhibition by azole antifungal agents. J Biol Chem 272(15):9986-8 | |ERG5 | ||||
| Fungal Related Genes/Proteins | Lamb DC, et al. (1997) Differential inhibition of Candida albicans CYP51 with azole antifungal stereoisomers. FEMS Microbiol Lett 149(1):25-30 | |||||
| Fungal Related Genes/Proteins | Lamb DC, et al. (1997) The mutation T315A in Candida albicans sterol 14alpha-demethylase causes reduced enzyme activity and fluconazole resistance through reduced affinity. J Biol Chem 272(9):5682-8 | |||||
| Alias Function/Process Strains/Constructs | Venkateswarlu K, et al. (1997) Characterization of Saccharomyces cerevisiae CYP51 and a CYP51 fusion protein with NADPH cytochrome P-450 oxidoreductase expressed in Escherichia coli. Antimicrob Agents Chemother 41(4):776-80 | |||||
| Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins | Aoyama Y, et al. (1996) Sterol 14-demethylase P450 (P45014DM*) is one of the most ancient and conserved P450 species. J Biochem 119(5):926-33 | |||||
| Alias Non-Fungal Related Genes/Proteins | van Nistelrooy JG, et al. (1996) Isolation and molecular characterisation of the gene encoding eburicol 14 alpha-demethylase (cYP51) from Penicillium italicum. Mol Gen Genet 250(6):725-33 | |||||
| Function/Process Protein Physical Properties | Barrett-Bee K and Dixon G (1995) Ergosterol biosynthesis inhibition: a target for antifungal agents. Acta Biochim Pol 42(4):465-79 | |ERG1 |ERG2 |ERG24 |ERG3 | ||||
| Fungal Related Genes/Proteins | Geber A, et al. (1995) Deletion of the Candida glabrata ERG3 and ERG11 genes: effect on cell viability, cell growth, sterol composition, and antifungal susceptibility. Antimicrob Agents Chemother 39(12):2708-17 | |ERG3 | ||||
| Alias Other Features Techniques and Reagents | Grausem B, et al. (1995) Functional expression of Saccharomyces cerevisiae CYP51A1 encoding lanosterol-14-demethylase in tobacco results in bypass of endogenous sterol biosynthetic pathway and resistance to an obtusifoliol-14-demethylase herbicide inhibitor. Plant J 7(5):761-70 | |||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Kelly SL, et al. (1995) Mode of action and resistance to azole antifungals associated with the formation of 14 alpha-methylergosta-8,24(28)-dien-3 beta,6 alpha-diol. Biochem Biophys Res Commun 207(3):910-5 | |||||
| Reviews | Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6 | |ERG1 |ERG2 |ERG24 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9 |FEN1 |FEN2 | ||||
| Reviews | Parks LW and Casey WM (1995) Physiological implications of sterol biosynthesis in yeast. Annu Rev Microbiol 49:95-116 | |ERG1 |ERG10 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG8 |MORE | ||||
| Reviews | Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30 | |ERG1 |ERG10 |ERG12 |ERG2 |ERG20 |ERG24 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG8 |ERG9 |HMG1 |MORE | ||||
| Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure | Boscott PE and Grant GH (1994) Modeling cytochrome P450 14 alpha demethylase (Candida albicans) from P450cam. J Mol Graph 12(3):185-92, 195 | |||||
| Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes | Bard M, et al. (1993) Sterol synthesis and viability of erg11 (cytochrome P450 lanosterol demethylase) mutations in Saccharomyces cerevisiae and Candida albicans. Lipids 28(11):963-7 | |ERG2 |ERG24 |ERG3 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs Techniques and Reagents | Doignon F, et al. (1993) Resistance to imidazoles and triazoles in Saccharomyces cerevisiae as a new dominant marker. Plasmid 30(3):224-33 | |||||
| Transcription | Fytlovich S, et al. (1993) Evidence for an interaction between the CYP1(HAP1) activator and a cellular factor during heme-dependent transcriptional regulation in the yeast Saccharomyces cerevisiae. EMBO J 12(3):1209-18 | |CYB2 |CYC1 |CYC7 |HAP1 | ||||
| Function/Process Substrates/Ligands/Cofactors | Kelly SL, et al. (1993) Benzo(a)pyrene hydroxylase activity in yeast is mediated by P450 other than sterol 14 alpha-demethylase. Biochem Biophys Res Commun 197(2):428-32 | |||||
| Substrates/Ligands/Cofactors | Aoyama Y and Yoshida Y (1992) The 4 beta-methyl group of substrate does not affect the activity of lanosterol 14 alpha-demethylase (P-450(14)DM) of yeast: difference between the substrate recognition by yeast and plant sterol 14 alpha-demethylases. Biochem Biophys Res Commun 183(3):1266-72 | |||||
| Regulation of | Aoyama Y, et al. (1992) Inhibition by a novel azole antifungal agent with a geranyl group on lanosterol 14 alpha-demethylase of yeast. Biochem Pharmacol 44(9):1701-5 | |||||
| Function/Process | Aoyama Y, et al. (1992) Structural analysis of the interaction between the side-chain of substrates and the active site of lanosterol 14 alpha-demethylase (P-450(14)DM) of yeast. Biochim Biophys Acta 1122(3):251-5 | |||||
| Alias DNA/RNA Sequence Features Mapping RNA Levels and Processing Regulation of Transcription | Del Carratore R, et al. (1992) Expression of cytochrome P450 in yeast after different chemical treatments. Carcinogenesis 13(11):2175-7 | |||||
| Reviews | Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press | |ACC1 |ACH1 |CDS1 |CHO1 |CHO2 |CKI1 |CTR1 |ERG1 |ERG10 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |MORE | ||||
| Alias Function/Process Mutants/Phenotypes Protein Sequence Features | Tuck SF, et al. (1992) Active site topology of Saccharomyces cerevisiae lanosterol 14 alpha-demethylase (CYP51) and its G310D mutant (cytochrome P-450SG1). J Biol Chem 267(19):13175-9 | |||||
| DNA/RNA Sequence Features Regulation of Transcription | Turi TG and Loper JC (1992) Multiple regulatory elements control expression of the gene encoding the Saccharomyces cerevisiae cytochrome P450, lanosterol 14 alpha-demethylase (ERG11). J Biol Chem 267(3):2046-56 | |ANB1 |HAP1 |HEM13 |NCP1 |ROX1 | ||||
| Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors | Weber JM, et al. (1992) Factors affecting homologous overexpression of the Saccharomyces cerevisiae lanosterol 14 alpha-demethylase gene. Yeast 8(7):519-33 | |||||
| Function/Process Non-Fungal Related Genes/Proteins Substrates/Ligands/Cofactors | Aoyama Y and Yoshida Y (1991) Different substrate specificities of lanosterol 14a-demethylase (P-45014DM) of Saccharomyces cerevisiae and rat liver for 24-methylene-24,25-dihydrolanosterol and 24,25-dihydrolanosterol. Biochem Biophys Res Commun 178(3):1064-71 | |||||
| Function/Process Substrates/Ligands/Cofactors Techniques and Reagents | Aoyama Y, et al. (1991) Role of the side chain of lanosterol in substrate recognition and catalytic activity of lanosterol 14 alpha-demethylase (cytochrome P-450 (14DM)) of yeast. Biochim Biophys Acta 1081(3):262-6 | |||||
| Other Features | Kelly SL, et al. (1991) Molecular genetic studies on the mode of action of azole antifungal agents. Biochem Soc Trans 19(3):796-8 | |||||
| Mutants/Phenotypes | Lorenz RT and Parks LW (1991) Physiological effects of fenpropimorph on wild-type Saccharomyces cerevisiae and fenpropimorph-resistant mutants. Antimicrob Agents Chemother 35(8):1532-7 | |ERG3 | ||||
| Other Features | Morichetti E, et al. (1991) Metabolism of 5-methoxypsoralen by Saccharomyces cerevisiae. Photochem Photobiol 54(5):689-95 | |||||
| Regulation of | Stansfield I, et al. (1991) Chemostat studies of microsomal enzyme induction in Saccharomyces cerevisiae. Yeast 7(2):147-56 | |CYB5 | ||||
| DNA/RNA Sequence Features Mapping | Turi TG, et al. (1991) Cytochrome P450 lanosterol 14 alpha-demethylase (ERG11) and manganese superoxide dismutase (SOD1) are adjacent genes in Saccharomyces cerevisiae. Yeast 7(6):627-30 | |SOD2 | ||||
| Function/Process Regulation of Transcription | Verdiere J, et al. (1991) CYP1 (HAP1) is a determinant effector of alternative expression of heme-dependent transcribed genes in yeast [corrected] Mol Gen Genet 228(1-2):300-6 | |HAP1 |HEM1 |HEM13 | ||||
| Reviews | Yoshida Y and Aoyama Y (1991) Sterol 14 alpha-demethylase and its inhibition: structural considerations on interaction of azole antifungal agents with lanosterol 14 alpha-demethylase (P-450(14DM)) of yeast. Biochem Soc Trans 19(3):778-82 | |||||
| Techniques and Reagents | King DJ, et al. (1990) An assay for lanosterol 14 alpha-demethylase from Saccharomyces cerevisiae. Biochem Soc Trans 18(5):1001-2 | |||||
| Function/Process Protein/Nucleic Acid Structure Substrates/Ligands/Cofactors | Wright GD, et al. (1990) Non-sterol structural probes of the lanosterol 14 alpha-demethylase from Saccharomyces cerevisiae. Biochim Biophys Acta 1040(1):95-101 | |||||
| Regulation of | Yoshida Y and Aoyama Y (1990) Stereoselective interaction of an azole antifungal agent with its target, lanosterol 14 alpha-demethylase (cytochrome P-45014DM): a model study with stereoisomers of triadimenol and purified cytochrome P-45014DM from yeast. Chirality 2(1):10-5 | |||||
| Function/Process | Aoyama Y, et al. (1989) Deformylation of 32-oxo-24,25-dihydrolanosterol by the purified cytochrome P-45014DM (lanosterol 14 alpha-demethylase) from yeast evidence confirming the intermediate step of lanosterol 14 alpha-demethylation. J Biol Chem 264(31):18502-5 | |||||
| Function/Process Substrates/Ligands/Cofactors | Aoyama Y, et al. (1989) Role of the 8-double bond of lanosterol in the enzyme-substrate interaction of cytochrome P-450(14DM) (lanosterol 14 alpha-demethylase). Biochim Biophys Acta 1001(2):196-200 | |||||
