---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

VMR1/YHL035C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVIII: 32754 to 27976 CDS: 32754 - 27976 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
VMR1	YHL035C		ORF, Verified	S000001027
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2003-08-26. Gene name expires on 2006-11-09.
Description
Protein of unknown function that may interact with ribosomes, based on co-purification experiments; member of the ATP-binding cassette (ABC) family; potential Cdc28p substrate; detected in purified mitochondria in high-throughput studies

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By ATP binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001140 , EBI:IPR003439 , EBI:IPR011527 , EBI:IPR017871 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0067 Assigned on 2007-05-23 UniProtKB ATPase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003439 , EBI:IPR017871 Assigned on 2007-05-23 UniProtKB ATPase activity, coupled to transmembrane movement of substances Gueldry O, et al. (2003) Ycf1p-dependent Hg(II) detoxification in Saccharomyces cerevisiae. Eur J Biochem 270(11):2486-96              ISS : Inferred from Sequence or structural Similarity Assigned on 2003-07-06 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001140 , EBI:IPR011527 Assigned on 2007-05-23 UniProtKB nucleoside-triphosphatase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003593 Assigned on 2007-05-23 UniProtKB nucleotide binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003593 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0547 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By regulation of cellular catabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transmembrane transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001140 , EBI:IPR011527 Assigned on 2009-10-01 UniProtKB transport Gueldry O, et al. (2003) Ycf1p-dependent Hg(II) detoxification in Saccharomyces cerevisiae. Eur J Biochem 270(11):2486-96              ISS : Inferred from Sequence or structural Similarity Assigned on 2003-07-06 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001140 , EBI:IPR011527 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane Gueldry O, et al. (2003) Ycf1p-dependent Hg(II) detoxification in Saccharomyces cerevisiae. Eur J Biochem 270(11):2486-96              ISS : Inferred from Sequence or structural Similarity Assigned on 2003-07-06 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001140 , EBI:IPR011527 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-05-05 UniProtKB mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12          IDA : Inferred from Direct Assay Assigned on 2004-09-28 SGD Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD colocalizes_with ribosome Fleischer TC, et al. (2006) Systematic identification and functional screens of uncharacterized proteins associated with eukaryotic ribosomal complexes. Genes Dev 20(10):1294-307          IDA : Inferred from Direct Assay Assigned on 2007-01-22 SGD vacuole GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0926 Assigned on 2009-05-05 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forVMR1/YHL035C for VMR1 1) Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC proteins. Nat Genet 15(2):137-45      2) Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64          3) Fleischer TC, et al. (2006) Systematic identification and functional screens of uncharacterized proteins associated with eukaryotic ribosomal complexes. Genes Dev 20(10):1294-307          4) Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            5) Wawrzycka, D., et al. (2003) A novel vacuolar multidrug resistance (VMR1) ABC transporter in Saccharomyces cerevisiae    6) Teixeira MC, et al. (2006) Early transcriptional response of Saccharomyces cerevisiae to stress imposed by the herbicide 2,4-dichlorophenoxyacetic acid. FEMS Yeast Res 6(2):230-48

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for VMR1/YHL035C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for VMR1/YHL035C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MGTDPLI C-term QSSKMMK Length(aa) 1,592 MW(Da) 180,924 pI 8.57 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.036   Codon Adaptation Index 0.136   Frequency of Optimal Codons 0.433   Hydropathicity of Protein 0.084   Aromaticity Score 0.099

10 20 30 40 50 | | | | | MGTDPLIIRNNGSFWEVDDFTRLGRTQLLSYYLPLAIIASIGIFALCRSG LSRYVRSAECDLVNEYLFGAQEERKEDNSIERLLRNSNTQANYVNVKKQG RILKLRHFDITTIDVKQIDAKNHGGLTFSRPSTSDHLRKSSEIVLMSLQI IGLSFLRVTKINIELTNRDVTTLLLFWLILLSLSILRVYKRSTNLWAICF TAHTTIWISTWIPIRSVYIGNIDDVPSQIFYIFEFVITSTLQPIKLTSPI KDNSSIIYVRDDHTSPSREHISSILSCITWSWITNFIWEAQKNTIKLKDI WGLSMEDYSIFILKGFTRRNKHINNLTLALFESFKTYLLIGMLWVLVNSI VNLLPTILMKRFLEIVDNPNRSSSCMNLAWLYIIGMFICRLTLAICNSQG QFVSDKICLRIRAILIGEIYAKGLRRRLFTSPKTSSDSDSISANLGTIIN LISIDSFKVSELANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILV MFPLNFLLANLLGKFQKQTLKCTDQRISKLNECLQNIRIVKYFAWERNII NEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFAICTFVQHED LNAPLAFTTLSLFTLLKTPLDQLSNMLSFINQSKVSLKRISDFLRMDDTE KYNQLTISPDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLI LGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIPDCEGLTNSFAY CSQSAWLLNDTVKNNIIFDNFYNEDRYNKVIDACGLKRDLEILPAGDLTE IGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENC ITGPLMKNRTCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKGL FKEKYVQLSSRDSINEKNANRLKAPRKNDSQKIEPVTENINFDANFVNDG QLIEEEEKSNGAISPDVYKWYLKFFGGFKALTALFALYITAQILFISQSW WIRHWVNDTNVRINAPGFAMDTLPLKGMTDSSKNKHNAFYYLTVYFLIGI IQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMN RFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPRFLTVAVIVFV LYFFVGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAFGDERRF ILENMNKIDQNNRAFFYLSVTVKWFSFRVDMIGAFIVLASGSFILLNIAN IDSGLAGISLTYAILFTDGALWLVRLYSTFEMNMNSVERLKEYSSIEQEN YLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPPVIRNVSFKVDPQ SKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSI TIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNS EERFNSTHNKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDE ATSSIDYDSDHLIQGIIRSEFNKSTILTIAHRLRSVIDYDRIIVMDAGEV KEYDRPSELLKDERGIFYSMCRDSGGLELLKQIAKQSSKMMK*

Protein Structures from PDB: proteins of known structure with sequence similarity to VMR1/YHL035C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to VMR1 Homolog Source (per PDB) Protein Alignment: VMR1 vs. Homolog External Links P-Value %Identical %Similar Alignment 3g5u ( Chain: B, A) Structure of p-glycoprotein reveals a molecular basis for poly-specific drug binding PDB_Info PDB_Structure Mus musculus Chain B = 1.0e-45 22 33 View alignment SCOP MMDB CATH Chain A = 1.0e-45 22 33 View alignment 3g60 ( Chain: A, B) Structure of p-glycoprotein reveals a molecular basis for poly-specific drug binding PDB_Info PDB_Structure Mus musculus Chain A = 1.3e-45 22 33 View alignment SCOP MMDB CATH Chain B = 1.3e-45 22 33 View alignment 3g61 ( Chain: A, B) Structure of p-glycoprotein reveals a molecular basis for poly-specific drug binding PDB_Info PDB_Structure Mus musculus Chain A = 1.3e-45 22 33 View alignment SCOP MMDB CATH Chain B = 1.3e-45 22 33 View alignment 3b5x ( Chain: B, A) Crystal structure of msba from vibrio cholerae PDB_Info PDB_Structure Vibrio cholerae Chain B = 1.5e-34 28 32 View alignment SCOP MMDB CATH Chain A = 1.5e-34 28 32 View alignment 2cbz ( Chain: A) Structure of the human multidrug resistance protein 1 nucleotide binding domain 1 PDB_Info PDB_Structure Homo sapiens 1.9e-34 44 25 View alignment SCOP MMDB CATH 2onj ( Chain: B, A) Structure of the multidrug abc transporter sav1866 from s. aureus in complex with amp-pnp PDB_Info PDB_Structure Staphylococcus aureus Chain B = 2.4e-34 26 34 View alignment SCOP MMDB CATH Chain A = 2.4e-34 26 34 View alignment 2hyd ( Chain: B, A) Multidrug abc transporter sav1866 PDB_Info PDB_Structure Staphylococcus aureus Chain B = 2.4e-34 26 34 View alignment SCOP MMDB CATH Chain A = 2.4e-34 26 34 View alignment 3b5w ( Chain: E, B, C, G, A, F, D, H) Crystal structure of eschericia coli msba PDB_Info PDB_Structure Escherichia coli Chain E = 1.7e-28 26 33 View alignment SCOP MMDB CATH Chain B = 1.7e-28 26 33 View alignment Chain C = 1.7e-28 26 33 View alignment Chain G = 1.7e-28 26 33 View alignment Chain A = 1.7e-28 26 33 View alignment Chain F = 1.7e-28 26 33 View alignment Chain D = 1.7e-28 26 33 View alignment Chain H = 1.7e-28 26 33 View alignment 3b5z ( Chain: B, C, D, A) Crystal structure of msba from salmonella typhimurium with adp vanadate PDB_Info PDB_Structure Salmonella typhimurium Chain B = 2.5e-28 26 34 View alignment SCOP MMDB CATH Chain C = 2.5e-28 26 34 View alignment Chain D = 2.5e-28 26 34 View alignment Chain A = 2.5e-28 26 34 View alignment 3b60 ( Chain: B, A, C, D) Crystal structure of msba from salmonella typhimurium with amppnp, higher resolution form PDB_Info PDB_Structure Salmonella typhimurium Chain B = 2.5e-28 26 34 View alignment SCOP MMDB CATH Chain A = 2.5e-28 26 34 View alignment Chain C = 2.5e-28 26 34 View alignment Chain D = 2.5e-28 26 34 View alignment 3b5y ( Chain: C, B, D, A) Crystal structure of msba from salmonella typhimurium with amppnp PDB_Info PDB_Structure Salmonella typhimurium Chain C = 2.5e-28 26 34 View alignment SCOP MMDB CATH Chain B = 2.5e-28 26 34 View alignment Chain D = 2.5e-28 26 34 View alignment Chain A = 2.5e-28 26 34 View alignment 1r0y ( Chain: A, C, B, D) Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with adp PDB_Info PDB_Structure Mus musculus Chain A = 9.6e-27 38 26 View alignment SCOP MMDB CATH Chain C = 9.6e-27 38 26 View alignment Chain B = 9.6e-27 38 26 View alignment Chain D = 9.6e-27 38 26 View alignment 1r10 ( Chain: A, B) Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp, i4122 space group PDB_Info PDB_Structure Mus musculus Chain A = 9.6e-27 38 26 View alignment SCOP MMDB CATH Chain B = 9.6e-27 38 26 View alignment 1r0z ( Chain: B, A, C, D) Phosphorylated cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp PDB_Info PDB_Structure Mus musculus Chain B = 9.6e-27 38 26 View alignment SCOP MMDB CATH Chain A = 9.6e-27 38 26 View alignment Chain C = 9.6e-27 38 26 View alignment Chain D = 9.6e-27 38 26 View alignment 1q3h ( Chain: D, A, C, B) Mouse cftr nbd1 with amp.pnp PDB_Info PDB_Structure Mus musculus Chain D = 9.6e-27 38 26 View alignment SCOP MMDB CATH Chain A = 9.6e-27 38 26 View alignment Chain C = 9.6e-27 38 26 View alignment Chain B = 9.6e-27 38 26 View alignment 1r0w ( Chain: B, D, C, A) Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) apo PDB_Info PDB_Structure Mus musculus Chain B = 9.6e-27 38 26 View alignment SCOP MMDB CATH Chain D = 9.6e-27 38 26 View alignment Chain C = 9.6e-27 38 26 View alignment Chain A = 9.6e-27 38 26 View alignment 1r0x ( Chain: B, C, D, A) Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp PDB_Info PDB_Structure Mus musculus Chain B = 9.6e-27 38 26 View alignment SCOP MMDB CATH Chain C = 9.6e-27 38 26 View alignment Chain D = 9.6e-27 38 26 View alignment Chain A = 9.6e-27 38 26 View alignment 1mt0 ( Chain: A) Atp-binding domain of haemolysin b from escherichia coli PDB_Info PDB_Structure Escherichia coli 1.2e-26 33 35 View alignment SCOP MMDB CATH 2ff7 ( Chain: A) The abc-atpase of the abc-transporter hlyb in the adp bound state PDB_Info PDB_Structure Escherichia coli 1.2e-26 33 35 View alignment SCOP MMDB CATH 2pmk ( Chain: A) Crystal structures of an isolated abc-atpase in complex with tnp-adp PDB_Info PDB_Structure Escherichia coli 1.2e-26 33 35 View alignment SCOP MMDB CATH 3b5j ( Chain: A) Crystal structures of the s504a mutant of an isolated abc- atpase in complex with tnp-adp PDB_Info PDB_Structure Escherichia coli 1.8e-26 33 35 View alignment SCOP MMDB CATH 2fgk ( Chain: A, B, D, C) Crystal structure of the abc-cassette e631q mutant of hlyb with bound atp PDB_Info PDB_Structure Escherichia coli Chain A = 2.4e-26 33 35 View alignment SCOP MMDB CATH Chain B = 2.4e-26 33 35 View alignment Chain D = 2.4e-26 33 35 View alignment Chain C = 2.4e-26 33 35 View alignment 2ffb ( Chain: A) The crystal structure of the hlyb-nbd e631q mutant in complex with adp PDB_Info PDB_Structure Escherichia coli 2.4e-26 33 35 View alignment SCOP MMDB CATH 1xfa ( Chain: A, B) Structure of nbd1 from murine cftr- f508r mutant PDB_Info PDB_Structure Mus musculus Chain A = 6.0e-26 38 25 View alignment SCOP MMDB CATH Chain B = 6.0e-26 38 25 View alignment 1xf9 ( Chain: D, A, C, B) Structure of nbd1 from murine cftr- f508s mutant PDB_Info PDB_Structure Mus musculus Chain D = 6.0e-26 38 25 View alignment SCOP MMDB CATH Chain A = 6.0e-26 38 25 View alignment Chain C = 6.0e-26 38 25 View alignment Chain B = 6.0e-26 38 25 View alignment 2pzg ( Chain: B, A) Minimal human cftr first nucleotide binding domain as a monomer PDB_Info PDB_Structure Homo sapiens Chain B = 6.7e-26 37 28 View alignment SCOP MMDB CATH Chain A = 6.7e-26 37 28 View alignment 1xef ( Chain: A, B, C, D) Crystal structure of the atp/mg2+ bound composite dimer of hlyb-nbd PDB_Info PDB_Structure Escherichia coli Chain A = 9.3e-26 33 34 View alignment SCOP MMDB CATH Chain B = 9.3e-26 33 34 View alignment Chain C = 9.3e-26 33 34 View alignment Chain D = 9.3e-26 33 34 View alignment 2fgj ( Chain: D, C, B, A) Crystal structure of the abc-cassette h662a mutant of hlyb with bound atp PDB_Info PDB_Structure Escherichia coli Chain D = 9.7e-26 33 34 View alignment SCOP MMDB CATH Chain C = 9.7e-26 33 34 View alignment Chain B = 9.7e-26 33 34 View alignment Chain A = 9.7e-26 33 34 View alignment 2ffa ( Chain: A) Crystal structure of abc-atpase h662a of the abc- transporter hlyb in complex with adp PDB_Info PDB_Structure Escherichia coli 9.7e-26 33 34 View alignment SCOP MMDB CATH 2pze ( Chain: B, A) Minimal human cftr first nucleotide binding domain as a head-to-tail dimer PDB_Info PDB_Structure Homo sapiens Chain B = 2.4e-25 38 27 View alignment SCOP MMDB CATH Chain A = 2.4e-25 38 27 View alignment 1mv5 ( Chain: C, B, D, A) Crystal structure of lmra atp-binding domain PDB_Info PDB_Structure Lactococcus lactis Chain C = 3.1e-25 36 33 View alignment SCOP MMDB CATH Chain B = 3.1e-25 36 33 View alignment Chain D = 3.1e-25 36 33 View alignment Chain A = 3.1e-25 36 33 View alignment 1xmi ( Chain: C, E, D, B, A) Crystal structure of human f508a nbd1 domain with atp PDB_Info PDB_Structure Homo sapiens Chain C = 1.4e-24 33 29 View alignment SCOP MMDB CATH Chain E = 1.4e-24 33 29 View alignment Chain D = 1.4e-24 33 29 View alignment Chain B = 1.4e-24 33 29 View alignment Chain A = 1.4e-24 33 29 View alignment 2bbs ( Chain: B, A) Human deltaf508 nbd1 with three solubilizing mutations PDB_Info PDB_Structure Homo sapiens Chain B = 3.0e-24 33 30 View alignment SCOP MMDB CATH Chain A = 3.0e-24 33 30 View alignment 2bbt ( Chain: B, A) Human deltaf508 nbd1 with two solublizing mutations. PDB_Info PDB_Structure Homo sapiens Chain B = 5.9e-24 33 29 View alignment SCOP MMDB CATH Chain A = 5.9e-24 33 29 View alignment 2pzf ( Chain: A, B) Minimal human cftr first nucleotide binding domain as a head-to-tail dimer with delta f508 PDB_Info PDB_Structure Homo sapiens Chain A = 6.8e-24 38 27 View alignment SCOP MMDB CATH Chain B = 6.8e-24 38 27 View alignment 2bbo ( Chain: A) Human nbd1 with phe508 PDB_Info PDB_Structure Homo sapiens 7.0e-24 33 29 View alignment SCOP MMDB CATH 1xmj ( Chain: A) Crystal structure of human deltaf508 human nbd1 domain with atp PDB_Info PDB_Structure Homo sapiens 1.9e-22 33 29 View alignment SCOP MMDB CATH 2ghi ( Chain: C, B, D, A) Crystal structure of plasmodium yoelii multidrug resistance protein 2 PDB_Info PDB_Structure Plasmodium yoelii yoelii str. 17XNL Chain C = 4.7e-22 33 32 View alignment SCOP MMDB CATH Chain B = 4.7e-22 33 32 View alignment Chain D = 4.7e-22 33 32 View alignment Chain A = 4.7e-22 33 32 View alignment 1jj7 ( Chain: A) Crystal structure of the c-terminal atpase domain of human tap1 PDB_Info PDB_Structure Homo sapiens 1.8e-16 26 37 View alignment SCOP MMDB CATH 2ixf ( Chain: B, C, A, D) Crystal structure of the atpase domain of tap1 with atp (d645q, q678h mutant) PDB_Info PDB_Structure Rattus norvegicus Chain B = 1.3e-15 28 33 View alignment SCOP MMDB CATH Chain C = 1.3e-15 28 33 View alignment Chain A = 1.3e-15 28 33 View alignment Chain D = 1.3e-15 28 33 View alignment 2ixe ( Chain: A, D) Crystal structure of the atpase domain of tap1 with atp (d645n mutant) PDB_Info PDB_Structure Rattus norvegicus Chain A = 8.2e-15 27 34 View alignment SCOP MMDB CATH Chain D = 8.2e-15 27 34 View alignment 2ixg ( Chain: A) Crystal structure of the atpase domain of tap1 with atp (s621a, g622v, d645n mutant) PDB_Info PDB_Structure Rattus norvegicus 1.9e-14 27 34 View alignment SCOP MMDB CATH 3dhw ( Chain: G, C, D, H) Crystal structure of methionine importer metni PDB_Info PDB_Structure Escherichia coli k12 Chain G = 1.7e-10 31 26 View alignment SCOP MMDB CATH Chain C = 1.7e-10 31 26 View alignment Chain D = 1.7e-10 31 26 View alignment Chain H = 1.7e-10 31 26 View alignment 3d31 ( Chain: B, A) Modbc from methanosarcina acetivorans PDB_Info PDB_Structure Methanosarcina acetivorans Chain B = 1.8e-09 29 34 View alignment SCOP MMDB CATH Chain A = 1.8e-09 29 34 View alignment 1z47 ( Chain: B, A) Structure of the atpase subunit cysa of the putative sulfate atp-binding cassette (abc) transporter from alicyclobacillus acidocaldarius PDB_Info PDB_Structure Alicyclobacillus acidocaldarius Chain B = 3.0e-09 24 34 View alignment SCOP MMDB CATH Chain A = 3.0e-09 24 34 View alignment 1f3o ( Chain: A) Crystal structure of mj0796 atp-binding cassette PDB_Info PDB_Structure Methanocaldococcus jannaschii 1.3e-08 25 36 View alignment SCOP MMDB CATH 1l2t ( Chain: B, A) Dimeric structure of mj0796, a bacterial abc transporter cassette PDB_Info PDB_Structure Methanocaldococcus jannaschii Chain B = 2.5e-08 25 36 View alignment SCOP MMDB CATH Chain A = 2.5e-08 25 36 View alignment 2onk ( Chain: B, G, F, A) Abc transporter modbc in complex with its binding protein moda PDB_Info PDB_Structure Archaeoglobus fulgidus Chain B = 2.6e-08 27 29 View alignment SCOP MMDB CATH Chain G = 2.6e-08 27 29 View alignment Chain F = 2.6e-08 27 29 View alignment Chain A = 2.6e-08 27 29 View alignment 1vpl ( Chain: A) Crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution PDB_Info PDB_Structure Thermotoga maritima MSB8 2.8e-08 25 34 View alignment SCOP MMDB CATH 3gfo ( Chain: A) Structure of cbio1 from clostridium perfringens: part of the abc transporter complex cbionq. PDB_Info PDB_Structure Clostridium perfringens ATCC 13124 3.1e-08 26 33 View alignment SCOP MMDB CATH 2yz2 ( Chain: A, B) Crystal structure of the abc transporter in the cobalt transport system PDB_Info PDB_Structure Thermotoga maritima MSB8 Chain A = 1.3e-07 26 31 View alignment SCOP MMDB CATH Chain B = 1.3e-07 26 31 View alignment 1ji0 ( Chain: A) Crystal structure analysis of the abc transporter from thermotoga maritima PDB_Info PDB_Structure Thermotoga maritima 1.6e-07 25 34 View alignment SCOP MMDB CATH 2it1 ( Chain: B, A) Structure of ph0203 protein from pyrococcus horikoshii PDB_Info PDB_Structure Pyrococcus horikoshii Chain B = 2.1e-07 23 34 View alignment SCOP MMDB CATH Chain A = 2.1e-07 23 34 View alignment 1oxv ( Chain: D, A, B) Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus PDB_Info PDB_Structure Sulfolobus solfataricus Chain D = 7.7e-07 24 34 View alignment SCOP MMDB CATH Chain A = 7.7e-07 24 34 View alignment Chain B = 7.7e-07 24 34 View alignment 1oxt ( Chain: D, A, B) Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus PDB_Info PDB_Structure Sulfolobus solfataricus Chain D = 7.7e-07 24 34 View alignment SCOP MMDB CATH Chain A = 7.7e-07 24 34 View alignment Chain B = 7.7e-07 24 34 View alignment 1oxu ( Chain: A, B, C) Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus PDB_Info PDB_Structure Sulfolobus solfataricus Chain A = 7.7e-07 24 34 View alignment SCOP MMDB CATH Chain B = 7.7e-07 24 34 View alignment Chain C = 7.7e-07 24 34 View alignment 1oxs ( Chain: C) Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus PDB_Info PDB_Structure Sulfolobus solfataricus 7.7e-07 24 34 View alignment SCOP MMDB CATH 3c41 ( Chain: K, J) Abc protein artp in complex with amp-pnp/mg2+ PDB_Info PDB_Structure Geobacillus stearothermophilus Chain K = 1.5e-06 25 32 View alignment SCOP MMDB CATH Chain J = 1.5e-06 25 32 View alignment 2yyz ( Chain: A) Crystal structure of sugar abc transporter, atp-binding protein PDB_Info PDB_Structure Thermotoga maritima MSB8 1.5e-06 23 32 View alignment SCOP MMDB CATH 3fvq ( Chain: A, B) Fe(3+) ions import ATP- PDB_Info PDB_Structure Unknown Chain A = 1.5e-06 27 31 View alignment SCOP MMDB CATH Chain B = 1.5e-06 27 31 View alignment 2olj ( Chain: A, B) Abc protein artp in complex with adp/mg2+ PDB_Info PDB_Structure Geobacillus stearothermophilus Chain A = 1.6e-06 25 32 View alignment SCOP MMDB CATH Chain B = 1.6e-06 25 32 View alignment 2q0h ( Chain: B, A) Abc protein artp in complex with adp/mg2+, atp-gamma-s hydrolyzed PDB_Info PDB_Structure Geobacillus stearothermophilus Chain B = 1.6e-06 25 32 View alignment SCOP MMDB CATH Chain A = 1.6e-06 25 32 View alignment 2olk ( Chain: B, A, C, D) Abc protein artp in complex with adp-beta-s PDB_Info PDB_Structure Geobacillus stearothermophilus Chain B = 1.6e-06 25 32 View alignment SCOP MMDB CATH Chain A = 1.6e-06 25 32 View alignment Chain C = 1.6e-06 25 32 View alignment Chain D = 1.6e-06 25 32 View alignment 2ouk ( Chain: C, A, B, D) Abc protein artp in complex with sulphate PDB_Info PDB_Structure Geobacillus stearothermophilus Chain C = 1.6e-06 25 32 View alignment SCOP MMDB CATH Chain A = 1.6e-06 25 32 View alignment Chain B = 1.6e-06 25 32 View alignment Chain D = 1.6e-06 25 32 View alignment 3c4j ( Chain: A, B) Abc protein artp in complex with atp-gamma-s PDB_Info PDB_Structure Geobacillus stearothermophilus Chain A = 1.6e-06 25 32 View alignment SCOP MMDB CATH Chain B = 1.6e-06 25 32 View alignment 1oxx ( Chain: K) Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus PDB_Info PDB_Structure Sulfolobus solfataricus 2.9e-06 24 34 View alignment SCOP MMDB CATH 1b0u ( Chain: A) Atp-binding subunit of the histidine permease from salmonella typhimurium PDB_Info PDB_Structure Salmonella typhimurium 6.2e-06 26 31 View alignment SCOP MMDB CATH 1v43 ( Chain: A) Crystal structure of atpase subunit of abc sugar transporter PDB_Info PDB_Structure Pyrococcus horikoshii 6.2e-06 25 31 View alignment SCOP MMDB CATH 1vci ( Chain: A) Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp PDB_Info PDB_Structure Pyrococcus horikoshii 6.4e-06 25 31 View alignment SCOP MMDB CATH 2d62 ( Chain: A) Crystal structure of multiple sugar binding transport atp- binding protein PDB_Info PDB_Structure Pyrococcus horikoshii 7.6e-06 28 25 View alignment SCOP MMDB CATH 2awn ( Chain: A, B, C, D) Crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) PDB_Info PDB_Structure Escherichia coli k12 Chain A = 9.2e-06 26 30 View alignment SCOP MMDB CATH Chain B = 9.2e-06 26 30 View alignment Chain C = 9.2e-06 26 30 View alignment Chain D = 9.2e-06 26 30 View alignment 2awo ( Chain: B, C, A, D) Crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) PDB_Info PDB_Structure Escherichia coli k12 Chain B = 9.2e-06 26 30 View alignment SCOP MMDB CATH Chain C = 9.2e-06 26 30 View alignment Chain A = 9.2e-06 26 30 View alignment Chain D = 9.2e-06 26 30 View alignment 1q12 ( Chain: D, C, A, B) Crystal structure of the atp-bound e. coli malk PDB_Info PDB_Structure Escherichia coli k12 Chain D = 9.2e-06 26 30 View alignment SCOP MMDB CATH Chain C = 9.2e-06 26 30 View alignment Chain A = 9.2e-06 26 30 View alignment Chain B = 9.2e-06 26 30 View alignment 3fh6 ( Chain: C, A, D, B) Crystal structure of the resting state maltose transporter from e. coli PDB_Info PDB_Structure Escherichia coli K-12 Chain C = 9.2e-06 26 30 View alignment SCOP MMDB CATH Chain A = 9.2e-06 26 30 View alignment Chain D = 9.2e-06 26 30 View alignment Chain B = 9.2e-06 26 30 View alignment 1q1e ( Chain: A, B) The atpase component of e. coli maltose transporter (malk) in the nucleotide-free form PDB_Info PDB_Structure Escherichia coli k12 Chain A = 9.2e-06 26 30 View alignment SCOP MMDB CATH Chain B = 9.2e-06 26 30 View alignment 1q1b ( Chain: B, A, D, C) Crystal structure of e. coli malk in the nucleotide-free form PDB_Info PDB_Structure Escherichia coli k12 Chain B = 9.2e-06 26 30 View alignment SCOP MMDB CATH Chain A = 9.2e-06 26 30 View alignment Chain D = 9.2e-06 26 30 View alignment Chain C = 9.2e-06 26 30 View alignment 2nq2 ( Chain: C, D) An inward-facing conformation of a putative metal-chelate type abc transporter. PDB_Info PDB_Structure Haemophilus influenzae Chain C = 9.8e-06 24 37 View alignment SCOP MMDB CATH Chain D = 9.8e-06 24 37 View alignment 2r6g ( Chain: B, A) The crystal structure of the e. coli maltose transporter PDB_Info PDB_Structure Escherichia coli k12 Chain B = 1.2e-05 26 30 View alignment SCOP MMDB CATH Chain A = 1.2e-05 26 30 View alignment 1g6h ( Chain: A) Crystal structure of the adp conformation of mj1267, an atp- binding cassette of an abc transporter PDB_Info PDB_Structure Methanocaldococcus jannaschii 1.9e-05 28 32 View alignment SCOP MMDB CATH 1gaj ( Chain: A) Crystal structure of a nucleotide-free atp-binding cassette from an abc transporter PDB_Info PDB_Structure Methanocaldococcus jannaschii 3.3e-05 27 33 View alignment SCOP MMDB CATH 1g9x ( Chain: B, C, A) Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter PDB_Info PDB_Structure Methanocaldococcus jannaschii Chain B = 4.5e-05 28 32 View alignment SCOP MMDB CATH Chain C = 4.5e-05 28 32 View alignment Chain A = 4.5e-05 28 32 View alignment 1sgw ( Chain: A) Putative abc transporter (atp-binding protein) from pyrococcus furiosus pfu-867808-001 PDB_Info PDB_Structure Pyrococcus furiosus DSM 3638 6.9e-05 26 32 View alignment SCOP MMDB CATH 1yqt ( Chain: A) Rnase-l inhibitor PDB_Info PDB_Structure Pyrococcus furiosus 0.000160 28 24 View alignment SCOP MMDB CATH 1g29 ( Chain: 1, 2) Malk PDB_Info PDB_Structure Thermococcus litoralis Chain 1 = 0.000219 22 32 View alignment SCOP MMDB CATH Chain 2 = 0.000219 22 32 View alignment 2ihy ( Chain: A, B) Structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter PDB_Info PDB_Structure Staphylococcus aureus Chain A = 0.000330 20 40 View alignment SCOP MMDB CATH Chain B = 0.000330 20 40 View alignment 3bk7 ( Chain: A) Structure of the complete abce1/rnaase-l inhibitor protein from pyrococcus abysii PDB_Info PDB_Structure Pyrococcus abyssi 0.001200 29 23 View alignment SCOP MMDB CATH 2pcj ( Chain: B, A) Crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 PDB_Info PDB_Structure Aquifex aeolicus VF5 Chain B = 0.001300 23 33 View alignment SCOP MMDB CATH Chain A = 0.001300 23 33 View alignment 2pcl ( Chain: A) Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5 PDB_Info PDB_Structure Aquifex aeolicus VF5 0.001300 23 33 View alignment SCOP MMDB CATH 2pjz ( Chain: A) The crystal structure of putative cobalt transport atp- binding protein (cbio-2), st1066 PDB_Info PDB_Structure Sulfolobus tokodaii 0.001899 30 29 View alignment SCOP MMDB CATH 2d3w ( Chain: D, B, C, A) Crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery PDB_Info PDB_Structure Escherichia coli Chain D = 0.006798 23 34 View alignment SCOP MMDB CATH Chain B = 0.006798 23 34 View alignment Chain C = 0.006798 23 34 View alignment Chain A = 0.006798 23 34 View alignment 2zu0 ( Chain: C, D) Crystal structure of sufc-sufd complex involved in the iron- sulfur cluster biosynthesis PDB_Info PDB_Structure Escherichia coli Chain C = 0.007498 23 34 View alignment SCOP MMDB CATH Chain D = 0.007498 23 34 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
VMR1	2006-11-17	Wawrzycka, D., et al. (2003) A novel vacuolar multidrug resistance (VMR1) ABC transporter in Saccharomyces cerevisiae    Teixeira MC, et al. (2006) Early transcriptional response of Saccharomyces cerevisiae to stress imposed by the herbicide 2,4-dichlorophenoxyacetic acid. FEMS Yeast Res 6(2):230-48

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YHL035C	SGD Systematic Sequence
856350	NCBI: Gene ID
NP_011828.1	NCBI: RefSeq protein version ID
NP_011828.1	NCBI: RefSeq protein version ID
6321752	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
Protein Details Topic Research Highlight Reference Contributor Protein Modification Description: Identified as an efficient substrate of Clb2-Cdk1-as1 in a screen of a proteomic GST-fusion library. Modification Type: Phosphorylation Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64          Jeff Ubersax 2004-01-27

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
23 curated references; 0 references not yet curated
Reviews	Paumi CM, et al. (2009) ABC transporters in Saccharomyces cerevisiae and their interactors: new technology advances the biology of the ABCC (MRP) subfamily. Microbiol Mol Biol Rev 73(4):577-93	|BAT1 |BPT1 |MRP1 |NFT1 |YBT1 |YCF1 |YKR104W |YOR1
RNA Levels and Processing	Tosato V, et al. (2009) DNA bridging of yeast chromosomes VIII leads to near-reciprocal translocation and loss of heterozygosity with minor cellular defects. Chromosoma 118(2):179-91	|CBP2 |CDC48 |CLB1 |DUR3 |GUT1 |MCA1 |RIM4 |RPS20 |SBP1 |SPO11 |STE20 |YHL017W |YLF2
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Function/Process	Fleischer TC, et al. (2006) Systematic identification and functional screens of uncharacterized proteins associated with eukaryotic ribosomal complexes. Genes Dev 20(10):1294-307	|AIM14 |AIM21 |ALB1 |ALE1 |ARB1 |BCH1 |DUG1 |ESL2 |GDE1 |GET4 |GIP3 |GVP36 |HER1 |IBI2 |MORE
Regulation of Transcription	Fry RC, et al. (2006) The DNA-damage signature in Saccharomyces cerevisiae is associated with single-strand breaks in DNA. BMC Genomics 7():313	|AAH1 |AHP1 |ALG14 |AMN1 |ASF1 |BAT1 |BUD4 |CAC2 |CAR1 |CDC42 |CDC8 |CHA1 |CHS2 |CIC1 |MORE
Reviews	Gbelska Y, et al. (2006) Evolution of gene families: the multidrug resistance transporter genes in five related yeast species. FEMS Yeast Res 6(3):345-55	|ADP1 |AQR1 |ATM1 |ATR1 |AUS1 |AZR1 |BPT1 |DTR1 |FLR1 |HOL1 |MDL1 |MDL2 |NFT1 |PDR10 |MORE
Transcription	Hazelwood LA, et al. (2006) A new physiological role for Pdr12p in Saccharomyces cerevisiae: export of aromatic and branched-chain organic acids produced in amino acid catabolism. FEMS Yeast Res 6(6):937-45	|ACT1 |ADP1 |ARB1 |ARO10 |ATM1 |ATR1 |AUS1 |BPT1 |ENB1 |MDL1 |MDL2 |NFT1 |PDR10 |PDR11 |MORE
RNA Levels and Processing Regulation of	Kawahata M, et al. (2006) Yeast genes involved in response to lactic acid and acetic acid: acidic conditions caused by the organic acids in Saccharomyces cerevisiae cultures induce expression of intracellular metal metabolism genes regulated by Aft1p. FEMS Yeast Res 6(6):924-36	|AFT1 |ARN1 |ARN2 |ATO3 |COT1 |CTS1 |DAK2 |DAL5 |DSE2 |EAF1 |EAF3 |EAF5 |EAF6 |EGT2 |MORE
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
DNA/RNA Sequence Features Regulation of Transcription	Courel M, et al. (2005) Direct activation of genes involved in intracellular iron use by the yeast iron-responsive transcription factor Aft2 without its paralog Aft1. Mol Cell Biol 25(15):6760-71	|AFT1 |AFT2 |AHP1 |AKR1 |ARA2 |ARN1 |ARN2 |ATX1 |BIO5 |BNA2 |CAD1 |CCC2 |COT1 |ECL1 |MORE
Reviews	Ernst R, et al. (2005) Yeast ATP-binding cassette transporters: cellular cleaning pumps. Methods Enzymol 400:460-84	|AUS1 |BPT1 |NFT1 |PDR10 |PDR11 |PDR12 |PDR15 |PDR5 |SNQ2 |YBT1 |YCF1 |YOR1
RNA Levels and Processing Regulation of	Lahue E, et al. (2005) The Saccharomyces cerevisiae Sub2 protein suppresses heterochromatic silencing at telomeres and subtelomeric genes. Yeast 22(7):537-51	|ADE1 |ADE13 |ADE17 |ADE2 |ADE6 |ADH4 |ARN1 |ARN2 |ARO10 |ARO9 |BDH2 |BNA2 |CCC2 |COS8 |MORE
Fungal Related Genes/Proteins	Wada S, et al. (2005) Phosphorylation of candida glabrata ATP-binding cassette transporter Cdr1p regulates drug efflux activity and ATPase stability. J Biol Chem 280(1):94-103	|ADP1 |AUS1 |GCN20 |PDR10 |PDR11 |PDR12 |PDR15 |PDR18 |PDR5 |SNQ2 |YBT1 |YCF1 |YOL075C
DNA/RNA Sequence Features Mutants/Phenotypes Regulation of Strains/Constructs Transcription	van Bakel H, et al. (2005) Gene expression profiling and phenotype analyses of S. cerevisiae in response to changing copper reveals six genes with new roles in copper and iron metabolism. Physiol Genomics 22(3):356-67	|AFT1 |AFT2 |AGA1 |AGA2 |AKR1 |ALD3 |ALD5 |AMS1 |APE2 |AQY2 |ARG1 |ARN1 |ARN2 |ATP7 |MORE
Function/Process	De Freitas JM, et al. (2004) Exploratory and confirmatory gene expression profiling of mac1Delta. J Biol Chem 279(6):4450-8	|AFT1 |AFT2 |AKR1 |CCC2 |FMP23 |FRE8 |MAC1 |MRS4 |PCA1 |SSU1 |TIS11 |YHR045W |YLR126C |YTP1
Reviews	Rutherford JC and Bird AJ (2004) Metal-responsive transcription factors that regulate iron, zinc, and copper homeostasis in eukaryotic cells. Eukaryot Cell 3(1):1-13	|ADE17 |ADH4 |AFT1 |AFT2 |AKR1 |ARN1 |ARN2 |ATX1 |BAG7 |BNA2 |CCC2 |COS1 |COS2 |COS3 |MORE
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Gueldry O, et al. (2003) Ycf1p-dependent Hg(II) detoxification in Saccharomyces cerevisiae. Eur J Biochem 270(11):2486-96	|BPT1 |YBT1 |YCF1 |YOR1
Regulation of Transcription	Rubin-Bejerano I, et al. (2003) Phagocytosis by neutrophils induces an amino acid deprivation response in Saccharomyces cerevisiae and Candida albicans. Proc Natl Acad Sci U S A 100(19):11007-12	|ADE1 |ADE12 |ADE13 |ADE16 |ADE17 |ADE2 |ADE3 |ADE4 |ADE5,7 |ADE6 |ADE8 |AKR2 |ALD5 |ARG1 |MORE
Alias DNA/RNA Sequence Features RNA Levels and Processing Regulation of	Rutherford JC, et al. (2003) Aft1p and Aft2p mediate iron-responsive gene expression in yeast through related promoter elements. J Biol Chem 278(30):27636-43	|AFT1 |AFT2 |AKR1 |ARA2 |ARN1 |ATX1 |BIO5 |BNA2 |CAD1 |COT1 |ECL1 |ECM4 |ENB1 |FET3 |MORE
Cellular Location	Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Protein Processing/Modification/Regulation Regulation of	Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64	|ACE2 |ACF4 |ACM1 |ADY3 |ALY2 |ARG1 |ASE1 |ASH1 |ATG20 |AXL2 |BBP1 |BCK2 |BEM1 |BEM3 |MORE
Reviews	Bauer BE, et al. (1999) Inventory and function of yeast ABC proteins: about sex, stress, pleiotropic drug and heavy metal resistance. Biochim Biophys Acta 1461(2):217-36	|ADP1 |ARB1 |ATM1 |AUS1 |BPT1 |CAF16 |GCN20 |HEF3 |MDL1 |MDL2 |NEW1 |NFT1 |PDR1 |PDR10 |MORE
Fungal Related Genes/Proteins Reviews	Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC proteins. Nat Genet 15(2):137-45	|ADP1 |ARB1 |ATM1 |AUS1 |BPT1 |CAF16 |GCN20 |HEF3 |MDL1 |MDL2 |NEW1 |NFT1 |PDR10 |PDR11 |MORE

Return to SGD

Send a Message to the SGD Curators