GOS1/YHL031C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVIII: 39484 to 38813
CDS: 39484 - 38813

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

GOS1 YHL031C ORF, Verified S000001023

Description
v-SNARE protein involved in Golgi transport, homolog of the mammalian protein GOS-28/GS28

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
SNAP receptor activity Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
intra-Golgi vesicle-mediated transport Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
response to drug Dilda PJ, et al. (2005) Mechanism of selectivity of an angiogenesis inhibitor from screening a genome-wide set of Saccharomyces cerevisiae deletion strains. J Natl Cancer Inst 97(20):1539-47
               IMP : Inferred from Mutant Phenotype
Assigned on 2007-01-08 SGD
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle fusion Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
Golgi apparatus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0333
Assigned on 2008-02-14 UniProtKB
integral to membrane McNew JA, et al. (1998) Gos1p, a Saccharomyces cerevisiae SNARE protein involved in Golgi transport. FEBS Lett 435(1):89-95
       NAS : Non-traceable Author Statement
ISS : Inferred from Sequence or structural Similarity
Assigned on 2002-08-27 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2008-02-14 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9908
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-11-20 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forGOS1/YHL031C for GOS1
1) McNew JA, et al. (1998) Gos1p, a Saccharomyces cerevisiae SNARE protein involved in Golgi transport. FEBS Lett 435(1):89-95

2) McNew JA, et al. (1997) Ykt6p, a prenylated SNARE essential for endoplasmic reticulum-Golgi transport. J Biol Chem 272(28):17776-83

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GOS1/YHL031C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GOS1/YHL031C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSSQPSF

C-term LFLFFTW

Length(aa) 223

MW(Da) 25,394

pI 10.2

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.142

Codon Adaptation Index 0.118

Frequency of Optimal Codons 0.500

Hydropathicity of Protein -0.513

Aromaticity Score 0.063

10 20 30 40 50 | | | | | MSSQPSFVTIRGKAISLETQTESLLSKYSTFAQTTSSEQTGQEKKIDKQL EGILGQRQDVIDSLTQICDSNPAISASKLSQLHRHKEILQDHWKSFRNIR SSIQQERNRLNLLFSVKNDIANSTTDAPAPIGDADEYIQNETRRIDQSNN VVDRLISQAWETRSQFHSQSNVLNTANNKVLQTLQRIPGVNQLIMKINTR RKKNAFVLATITTLCILFLFFTW*

Protein Structures from PDB: proteins of known structure with sequence similarity to GOS1/YHL031C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
GOS1 SGD (2007) Information without a citation in SGD

Standard Name	Reference
GOS1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YHL031C SGD Systematic Sequence

856354 NCBI: Gene ID

NP_011832.1 NCBI: RefSeq protein version ID

NP_011832.1 NCBI: RefSeq protein version ID

6321756 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YHL031C	SGD Systematic Sequence
856354	NCBI: Gene ID
NP_011832.1	NCBI: RefSeq protein version ID
NP_011832.1	NCBI: RefSeq protein version ID
6321756	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
24 curated references; 0 references not yet curated
Non-Fungal Related Genes/Proteins
Thorsen M, et al. (2009) Genetic basis of arsenite and cadmium tolerance in Saccharomyces cerevisiae. BMC Genomics 10:105
       |ACO1 |ADA2 |ADE8 |AKR1 |ARD1 |BIM1 |BRO1 |CCR4 |CHC1 |COQ6 |COX15 |CYS3 |DOA1 |ELM1 |MORE
Mutants/Phenotypes
Strains/Constructs
Grossmann G, et al. (2008) Plasma membrane microdomains regulate turnover of transport proteins in yeast. J Cell Biol 183(6):1075-88
       |CAN1 |CAX4 |COG1 |ELP6 |ERG2 |ERG24 |ERG5 |ERG6 |FUR4 |FYV6 |HNT3 |MDG1 |MNN10 |MNN11 |MORE
Genetic Interactions
Mitchell L, et al. (2008) Functional dissection of the NuA4 histone acetyltransferase reveals its role as a genetic hub and that Eaf1 is essential for complex integrity. Mol Cell Biol 28(7):2244-56
       |COG5 |COG6 |COG7 |COG8 |EAF1 |EAF3 |EAF5 |EAF6 |EAF7 |ESA1 |FKS1 |GET1 |GET2 |HSP12 |MORE
Cell Cycle Phase Involved
Mutants/Phenotypes
Regulation of
Strains/Constructs
Niu W, et al. (2008) Mechanisms of Cell Cycle Control Revealed by a Systematic and Quantitative Overexpression Screen in S. cerevisiae. PLoS Genet 4(7):e1000120
         |ACT1 |AIM20 |ALG6 |AME1 |ARC1 |ARF1 |ASK1 |ATG26 |AVO2 |BET4 |BUL1 |CBF1 |CDC31 |CDC39 |MORE
Cellular Location
Mutants/Phenotypes
Regulation of
Strains/Constructs
Schuldiner M, et al. (2008) The GET complex mediates insertion of tail-anchored proteins into the ER membrane. Cell 134(4):634-45
       |BOS1 |GET1 |GET2 |GET3 |KAR2 |PEP12 |PEX15 |SBH1 |SBH2 |SCS2 |SEC22 |SED5 |TLG2 |UBC6 |MORE
Fungal Related Genes/Proteins
Kuratsu M, et al. (2007) Systematic analysis of SNARE localization in the filamentous fungus Aspergillus oryzae. Fungal Genet Biol 44(12):1310-23
       |BET1 |BOS1 |NYV1 |PEP12 |SEC20 |SEC22 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |MORE
Protein-protein Interactions
Strains/Constructs
Shestakova A, et al. (2007) Interaction of the conserved oligomeric Golgi complex with t-SNARE Syntaxin5a/Sed5 enhances intra-Golgi SNARE complex stability. J Cell Biol 179(6):1179-92
       |BET1 |BOS1 |COG1 |COG2 |SEC22 |SED5 |SFT1
Mutants/Phenotypes
Techniques and Reagents
Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109
       |ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Cellular Location
Strains/Constructs
Matsuura-Tokita K, et al. (2006) Live imaging of yeast Golgi cisternal maturation. Nature 441(7096):1007-10
       |RER1 |RET1 |SEC7 |SED5
Mutants/Phenotypes
Dilda PJ, et al. (2005) Mechanism of selectivity of an angiogenesis inhibitor from screening a genome-wide set of Saccharomyces cerevisiae deletion strains. J Natl Cancer Inst 97(20):1539-47
               |ACO1 |ADE1 |ARG82 |BRE1 |CBF1 |CCR4 |CSG2 |CSM1 |CYS3 |CYS4 |EAP1 |ECM25 |ELM1 |EMI2 |MORE
Reviews
Hong W (2005) SNAREs and traffic. Biochim Biophys Acta 1744(2):120-44
       |BET1 |BOS1 |NYV1 |PEP12 |SEC20 |SEC22 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |MORE
Cellular Location
Inadome H, et al. (2005) Immunoisolaton of the yeast Golgi subcompartments and characterization of a novel membrane protein, Svp26, discovered in the Sed5-containing compartments. Mol Cell Biol 25(17):7696-710
       |AKR1 |ANP1 |ARF1 |ATG27 |DPM1 |EHT1 |EMP24 |EMP47 |ERP1 |ERP2 |ERV14 |ERV25 |ERV41 |ERV46 |MORE
Function/Process
Genetic Interactions
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Protein Sequence Features
Reviews
Burri L and Lithgow T (2004) A complete set of SNAREs in yeast. Traffic 5(1):45-52
       |BET1 |BOS1 |FRT1 |FRT2 |NYV1 |PEP12 |SEC20 |SEC22 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SSO1 |MORE
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gillingham AK, et al. (2002) CASP, the alternatively spliced product of the gene encoding the CCAAT-displacement protein transcription factor, is a Golgi membrane protein related to giantin. Mol Biol Cell 13(11):3761-74
       |COY1
Function/Process
Protein-protein Interactions
Parlati F, et al. (2002) Distinct SNARE complexes mediating membrane fusion in Golgi transport based on combinatorial specificity. Proc Natl Acad Sci U S A 99(8):5424-9
         |BOS1 |SEC22 |SED5 |SFT1 |YKT6
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Bensen ES, et al. (2001) Ric1p and the Ypt6p GTPase function in a common pathway required for localization of trans-Golgi network membrane proteins. Mol Biol Cell 12(1):13-26
       |END3 |KEX2 |PEP1 |RIC1 |SED5 |SLY1 |SYS1 |YKT6 |YPT6
Function/Process
Mutants/Phenotypes
Siniossoglou S and Pelham HR (2001) An effector of Ypt6p binds the SNARE Tlg1p and mediates selective fusion of vesicles with late Golgi membranes. EMBO J 20(21):5991-8
       |RGP1 |RIC1 |TLG1 |VPS52 |VPS53 |VPS54 |YPT6
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Tsui MM, et al. (2001) Selective formation of Sed5p-containing SNARE complexes is mediated by combinatorial binding interactions. Mol Biol Cell 12(3):521-38
       |BET1 |BOS1 |NYV1 |PEP12 |SEC22 |SED5 |SFT1 |SNC2 |TLG1 |VAM3 |VAM7 |VTI1 |YKT6
Function/Process
Protein-protein Interactions
Tsui MM and Banfield DK (2000) Yeast Golgi SNARE interactions are promiscuous. J Cell Sci 113 ( Pt 1)():145-52
       |BET1 |BOS1 |SEC22 |SED5 |SFT1 |VTI1 |YKT6
Reviews
Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       |NYV1 |SEC20 |SEC22 |SEC9 |SED5 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |TLG1 |TLG2 |UFE1 |VAM3 |MORE
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
McNew JA, et al. (1998) Gos1p, a Saccharomyces cerevisiae SNARE protein involved in Golgi transport. FEBS Lett 435(1):89-95
       |KAR2 |SEC17 |SED5
Function/Process
Fungal Related Genes/Proteins
Protein-protein Interactions
McNew JA, et al. (1997) Ykt6p, a prenylated SNARE essential for endoplasmic reticulum-Golgi transport. J Biol Chem 272(28):17776-83
       |SEC17 |SEC18 |SED5 |SFT1 |YKT6

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.