---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

LAG1/YHL003C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVIII: 101879 to 100644 CDS: 101879 - 100644 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
LAG1	YHL003C		ORF, Verified	S000000995
Description
Ceramide synthase component, involved in synthesis of ceramide from C26(acyl)-coenzyme A and dihydrosphingosine or phytosphingosine, functionally equivalent to Lac1p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By sphingosine N-acyltransferase activity Guillas I, et al. (2001) C26-CoA-dependent ceramide synthesis of Saccharomyces cerevisiae is operated by Lag1p and Lac1p. EMBO J 20(11):2655-65        IMP : Inferred from Mutant Phenotype Assigned on 2004-02-06 SGD Schorling S, et al. (2001) Lag1p and Lac1p are essential for the Acyl-CoA-dependent ceramide synthase reaction in Saccharomyces cerevisae. Mol Biol Cell 12(11):3417-27        IMP : Inferred from Mutant Phenotype Assigned on 2004-02-06 SGD Vallee B and Riezman H (2005) Lip1p: a novel subunit of acyl-CoA ceramide synthase. EMBO J 24(4):730-41          IDA : Inferred from Direct Assay Assigned on 2005-04-19 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.3.1.24 Assigned on 2008-02-13 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2008-02-14 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By ceramide biosynthetic process Schorling S, et al. (2001) Lag1p and Lac1p are essential for the Acyl-CoA-dependent ceramide synthase reaction in Saccharomyces cerevisae. Mol Biol Cell 12(11):3417-27        IMP : Inferred from Mutant Phenotype Assigned on 2003-01-30 SGD Vallee B and Riezman H (2005) Lip1p: a novel subunit of acyl-CoA ceramide synthase. EMBO J 24(4):730-41          IDA : Inferred from Direct Assay Assigned on 2005-04-19 SGD lipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0444 Assigned on 2008-02-14 UniProtKB lipid metabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0443 Assigned on 2009-10-01 UniProtKB peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT replicative cell aging D'mello NP, et al. (1994) Cloning and characterization of LAG1, a longevity-assurance gene in yeast. J Biol Chem 269(22):15451-9      IMP : Inferred from Mutant Phenotype IEP : Inferred from Expression Pattern Assigned on 2003-08-14 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Kumar A, et al. (2002) Subcellular localization of the yeast proteome. Genes Dev 16(6):707-19              IDA : Inferred from Direct Assay Assigned on 2002-05-07 SGD Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91          IDA : Inferred from Direct Assay Assigned on 2003-10-28 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2008-02-14 UniProtKB integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006634 , EBI:IPR016439 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2009-01-12 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
sphingolipid metabolism

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for LAG1/YHL003C for LAG1 LAG1 was identified as a gene whose expression decreases with increasing age of yeast cells (1). Deletion of LAG1 results in a 50% increase in the lifespan of the mutated yeast cells (1). LAC1 was identified as a close homolog of LAG1, and a double deletion of the two genes has been reported as lethal (2) or poor-growing (3). Human and C. elegans homologs of LAG1 have been cloned, and each is able to complement a lag1 lac1 double deletion (2). Lag1p and Lac1p have been localized to the endoplasmic reticulum, and are thought to play a role in the transport from the ER to the Golgi of glycosylphosphatidylinositol (GPI)-anchored proteins (3). About sphingolipid metabolism Sphingolipids are essential components of the plasma membrane in all eukaryotic cells. S. cerevisiae cells make three complex sphingolipids: inositol-phosphoceramide (IPC), mannose-inositol-phosphoceramide (MIPC), and mannose-(inositol phosphate)2-ceramide (M(IP)2C)(4). In the yeast plasma membrane sphingolipids concentrate with ergosterol to form lipid rafts, specialized membrane microdomains implicated in a variety of cellular processes, including sorting of membrane proteins and lipids, as well as organizing and regulating signaling cascades (5). Intermediates in sphingolipid biosynthesis have been shown to play important roles as signaling molecules and growth regulators. Sphingolipid long chain bases (LCBs), dihydrosphingosine (DHS) and phytosphingosine (PHS), have been implicated as secondary messengers in signaling pathways that regulate heat stress response (6, 7). Other intermediates, phytoceramide and long-chain base phosphates (LCBPs), have been shown to be components of the tightly-controlled ceramide/LCBP rheostat, which regulates cell growth (8). Since phosphoinositol-containing sphingolipids are unique to fungi, the sphingolipid biosynthesis pathway is considered a target for antifungal drugs (9, 10). Last Updated: 2007-10-05

Basic References [TOP]

BASIC INFORMATION REFERENCES forLAG1/YHL003C for LAG1 1) D'mello NP, et al. (1994) Cloning and characterization of LAG1, a longevity-assurance gene in yeast. J Biol Chem 269(22):15451-9      2) Jiang JC, et al. (1998) Homologs of the yeast longevity gene LAG1 in Caenorhabditis elegans and human. Genome Res 8(12):1259-72        3) Barz WP and Walter P (1999) Two endoplasmic reticulum (ER) membrane proteins that facilitate ER-to-Golgi transport of glycosylphosphatidylinositol-anchored proteins. Mol Biol Cell 10(4):1043-59        4) Dickson RC and Lester RL (2002) Sphingolipid functions in Saccharomyces cerevisiae. Biochim Biophys Acta 1583(1):13-25            5) Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80        6) Jenkins GM, et al. (1997) Involvement of yeast sphingolipids in the heat stress response of Saccharomyces cerevisiae. J Biol Chem 272(51):32566-72        7) Ferguson-Yankey SR, et al. (2002) Mutant analysis reveals complex regulation of sphingolipid long chain base phosphates and long chain bases during heat stress in yeast. Yeast 19(7):573-86      8) Kobayashi SD and Nagiec MM (2003) Ceramide/long-chain base phosphate rheostat in Saccharomyces cerevisiae: regulation of ceramide synthesis by Elo3p and Cka2p. Eukaryot Cell 2(2):284-94        9) Nagiec MM, et al. (1997) Sphingolipid synthesis as a target for antifungal drugs. Complementation of the inositol phosphorylceramide synthase defect in a mutant strain of Saccharomyces cerevisiae by the AUR1 gene. J Biol Chem 272(15):9809-17        10) Sugimoto Y, et al. (2004) IPC synthase as a useful target for antifungal drugs. Curr Drug Targets Infect Disord 4(4):311-22        11) Jazwinski SM (2002) Growing old: metabolic control and yeast aging. Annu Rev Microbiol 56:769-92

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for LAG1/YHL003C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for LAG1/YHL003C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MTSATDK C-term ESKEKCE Length(aa) 411 MW(Da) 48,454 pI 9.56 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.069   Codon Adaptation Index 0.158   Frequency of Optimal Codons 0.450   Hydropathicity of Protein 0.123   Aromaticity Score 0.173

10 20 30 40 50 | | | | | MTSATDKSIDRLVVNAKTRRRNSSVGKIDLGDTVPGFAAMPESAASKNEA KKRMKALTGDSKKDSDLLWKVWFSYREMNYRHSWLTPFFILVCVYSAYFL SGNRTESNPLHMFVAISYQVDGTDSYAKGIKDLSFVFFYMIFFTFLREFL MDVVIRPFTVYLNVTSEHRQKRMLEQMYAIFYCGVSGPFGLYIMYHSDLW LFKTKPMYRTYPVITNPFLFKIFYLGQAAFWAQQACVLVLQLEKPRKDYK ELVFHHIVTLLLIWSSYVFHFTKMGLAIYITMDVSDFFLSLSKTLNYLNS VFTPFVFGLFVFFWIYLRHVVNIRILWSVLTEFRHEGNYVLNFATQQYKC WISLPIVFVLIAALQLVNLYWLFLILRILYRLIWQGIQKDERSDSDSDES AENEESKEKCE*

Protein Structures from PDB: proteins of known structure with sequence similarity to LAG1/YHL003C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
LAG1	D'mello NP, et al. (1994) Cloning and characterization of LAG1, a longevity-assurance gene in yeast. J Biol Chem 269(22):15451-9

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YHL003C	SGD Systematic Sequence
856386	NCBI: Gene ID
NP_011860.1	NCBI: RefSeq protein version ID
NP_011860.1	NCBI: RefSeq protein version ID
6321784	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
60 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Cerantola V, et al. (2009) Aureobasidin A arrests growth of yeast cells through both ceramide intoxication and deprivation of essential inositolphosphorylceramides. Mol Microbiol 71(6):1523-37	|AUR1 |LAC1 |YDC1 |YPC1
Reviews	Edinger AL (2009) Starvation in the midst of plenty: making sense of ceramide-induced autophagy by analysing nutrient transporter expression. Biochem Soc Trans 37(Pt 1):253-8
Regulation of Transcription	Li L, et al. (2009) Budding yeast SSD1-V regulates transcript levels of many longevity genes and extends chronological life span in purified quiescent cells. Mol Biol Cell 20(17):3851-64	|AFT1 |ATG1 |ATG12 |ATG13 |ATG17 |CCZ1 |CKB2 |COG8 |CYR1 |DHH1 |DOT1 |GAT1 |GIM3 |HAL9 |MORE
Disease Gene Related Reviews	Ozbayraktar FB and Ulgen KO (2009) Molecular facets of sphingolipids: mediators of diseases. Biotechnol J 4(7):1028-41	|AUR1 |CSG2 |CSH1 |IPT1 |ISC1 |LAC1 |LCB1 |LCB2 |LCB4 |LCB5 |SCS7 |SUR1 |SUR2 |TSC10 |MORE
Disease Gene Related Non-Fungal Related Genes/Proteins Reviews	Teufel A, et al. (2009) The longevity assurance homologue of yeast lag1 (Lass) gene family (Review). Int J Mol Med 23(2):135-40	|LAC1
Transcription	Yu L, et al. (2009) Microarray analysis of p-anisaldehyde-induced transcriptome of Saccharomyces cerevisiae. J Ind Microbiol Biotechnol	|AAD10 |AAD14 |AAD16 |AAD4 |AAD6 |ADE6 |ADH6 |CBF1 |CYS4 |FEN1 |MET1 |MET10 |MET13 |MET14 |MORE
Non-Fungal Related Genes/Proteins	de Zelicourt A, et al. (2009) Susceptibility of Phelipanche and Orobanche species to AAL-toxin. Planta 230(5):1047-55
Strains/Constructs	Ponnusamy S, et al. (2008) Regulation of Telomere Length by Fatty Acid Elongase 3 in Yeast: INVOLVEMENT OF INOSITOL PHOSPHATE METABOLISM AND Ku70/80 FUNCTION. J Biol Chem 283(41):27514-24	|ARG82 |ELO1 |EST1 |FEN1 |IPK1 |ISC1 |KCS1 |RAD50 |SUR4 |TEL1 |YKU70 |YKU80
Reviews	Steinkraus KA, et al. (2008) Replicative aging in yeast: the means to the end. Annu Rev Cell Dev Biol 24:29-54	|ATP2 |FOB1 |GCN4 |GLK1 |GPA1 |GPR1 |HAP4 |HST1 |HST2 |HST3 |HST4 |HXK1 |LAT1 |MPT5 |MORE
Fungal Related Genes/Proteins	Takakuwa N, et al. (2008) Significance of the KlLAC1 gene in glucosylceramide production by Kluyveromyces lactis. FEMS Yeast Res 8(6):839-45	|LAC1
Reviews	Thevissen K, et al. (2008) Joined in death: highlights of the Sixth International Meeting on Yeast Apoptosis in Leuven, Belgium, 30 April-4 May 2008. Yeast 25(12):927-34	|BRE1 |MCA1
Computational analysis	Alvarez-Vasquez F, et al. (2007) Coordination of the dynamics of yeast sphingolipid metabolism during the diauxic shift. Theor Biol Med Model 4:42	|AUR1 |DPP1 |ELO1 |FAS1 |FAS2 |FEN1 |GPT2 |IPT1 |LAC1 |LCB1 |LCB2 |LCB4 |LCB5 |LIP1 |MORE
Cross-species Expression Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Cerantola V, et al. (2007) Yeast sphingolipids do not need to contain very long chain fatty acids. Biochem J 401(1):205-216	|LAC1 |LIP1 |YDC1 |YPC1
Reviews	Cowart LA and Obeid LM (2007) Yeast sphingolipids: recent developments in understanding biosynthesis, regulation, and function. Biochim Biophys Acta 1771(3):421-31	|AUR1 |CSG2 |CSH1 |DPL1 |FEN1 |ISC1 |LAC1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |SUR1 |SUR4 |MORE
Reviews	Kihara A, et al. (2007) Metabolism and biological functions of two phosphorylated sphingolipids, sphingosine 1-phosphate and ceramide 1-phosphate. Prog Lipid Res 46(2):126-44	|DPL1 |LAC1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |SUR2 |TSC10 |TSC3 |YDC1 |YPC1 |YSR3
Non-Fungal Related Genes/Proteins	Senkal CE, et al. (2007) Role of human longevity assurance gene 1 and C18-ceramide in chemotherapy-induced cell death in human head and neck squamous cell carcinomas. Mol Cancer Ther 6(2):712-22
Regulation of	Sun W, et al. (2007) Detection of eQTL modules mediated by activity levels of transcription factors. Bioinformatics 23(17):2290-7	|ACE2 |AMN1 |AQR1 |ARA1 |ARO80 |ARR1 |ATG19 |AZF1 |CAT5 |CHA4 |CNS1 |CSH1 |CUP9 |DEM1 |MORE
Non-Fungal Related Genes/Proteins	Wang B, et al. (2007) Cloning and characterization of a LASS1-GDF1 transcript in rat cerebral cortex: conservation of a bicistronic structure. DNA Seq 18(2):92-103
Cellular Location Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs Techniques and Reagents	Kageyama-Yahara N and Riezman H (2006) Transmembrane topology of ceramide synthase in yeast. Biochem J 398(3):585-93	|LAC1
Mutants/Phenotypes Strains/Constructs	Meier KD, et al. (2006) Sphingoid base is required for translation initiation during heat stress in Saccharomyces cerevisiae. Mol Biol Cell 17(3):1164-75	|EAP1 |HSP26 |LAC1 |LCB1 |LCB4 |LCB5 |MSN2 |PKH1 |PKH2 |SSA1 |UBI4 |YPK1 |YPK2
Non-Fungal Related Genes/Proteins	Mihm M, et al. (2006) Molecular evidence that growth of dominant follicles involves a reduction in follicle-stimulating hormone dependence and an increase in luteinizing hormone dependence in cattle. Biol Reprod 74(6):1051-9
Reviews	Riezman H (2006) Organization and functions of sphingolipid biosynthesis in yeast. Biochem Soc Trans 34(3):367-369	|AUR1 |CSG2 |DPL1 |IPT1 |LAC1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |SUR1 |SUR2 |TSC3 |MORE
Cross-species Expression Non-Fungal Related Genes/Proteins Strains/Constructs	Schulz A, et al. (2006) The CLN9 protein, a regulator of dihydroceramide synthase. J Biol Chem 281(5):2784-94
Non-Fungal Related Genes/Proteins	Spassieva S, et al. (2006) Necessary role for the Lag1p motif in (dihydro)ceramide synthase activity. J Biol Chem 281(45):33931-8
Cross-species Expression Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins	Yu Y, et al. (2006) Expression of LASS2 controlled by LAG1 or ADH1 promoters cannot functionally complement Lag1p. Microbiol Res 161(3):203-11	|LAC1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22	|ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |CSG2 |DPL1 |ELO1 |ERG24 |ERG3 |ERG4 |ERG5 |FEN1 |HEM1 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs Techniques and Reagents	Vallee B and Riezman H (2005) Lip1p: a novel subunit of acyl-CoA ceramide synthase. EMBO J 24(4):730-41	|LAC1 |LIP1
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein-protein Interactions Transcription	Jiang JC, et al. (2004) Suppressor analysis points to the subtle role of the LAG1 ceramide synthase gene in determining yeast longevity. Exp Gerontol 39(7):999-1009	|LAC1 |YDC1 |YPC1
DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Regulation of Strains/Constructs Transcription	Kolaczkowski M, et al. (2004) Differential regulation of ceramide synthase components LAC1 and LAG1 in Saccharomyces cerevisiae. Eukaryot Cell 3(4):880-92	|CBF1 |LAC1 |LCB2 |PDR1 |PDR3 |ROX1 |SUR2
Disease Gene Related Non-Fungal Related Genes/Proteins	Koybasi S, et al. (2004) Defects in cell growth regulation by C18:0-ceramide and longevity assurance gene 1 in human head and neck squamous cell carcinomas. J Biol Chem 279(43):44311-9
Non-Fungal Related Genes/Proteins	Cai XF, et al. (2003) Molecular cloning, characterisation and tissue-specific expression of human LAG3, a member of the novel Lag1 protein family. DNA Seq 14(2):79-86
Reviews	Fabrizio P and Longo VD (2003) The chronological life span of Saccharomyces cerevisiae. Aging Cell 2(2):73-81	|CTT1 |CYR1 |DDR2 |LAG2 |MSN2 |MSN4 |RAS2 |RTG2 |SCH9 |SOD1 |SOD2
Cross-species Expression Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Guillas I, et al. (2003) Human homologues of LAG1 reconstitute Acyl-CoA-dependent ceramide synthesis in yeast. J Biol Chem 278(39):37083-91	|LAC1
Reviews	Obeid LM and Hannun YA (2003) Ceramide, stress, and a "LAG" in aging. Sci Aging Knowledge Environ 2003(39):PE27
Reviews	Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80	|AUR1 |CSG2 |IPT1 |LAC1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |SUR1 |SUR2 |TSC10 |YSR3
Reviews	Funato K, et al. (2002) Biosynthesis and trafficking of sphingolipids in the yeast Saccharomyces cerevisiae. Biochemistry 41(51):15105-14	|ACB1 |AUR1 |CCC2 |CSG2 |DPL1 |ELO1 |FEN1 |FMP45 |IFA38 |IPT1 |ISC1 |LAC1 |LCB1 |LCB2 |MORE
Reviews	Hannun YA and Obeid LM (2002) The Ceramide-centric universe of lipid-mediated cell regulation: stress encounters of the lipid kind. J Biol Chem 277(29):25847-50	|LAC1
Reviews	Jazwinski SM (2002) Growing old: metabolic control and yeast aging. Annu Rev Microbiol 56:769-92
Cellular Location Function/Process Non-Fungal Related Genes/Proteins Reviews	Jazwinski SM and Conzelmann A (2002) LAG1 puts the focus on ceramide signaling. Int J Biochem Cell Biol 34(11):1491-5
Function/Process Non-Fungal Related Genes/Proteins	Venkataraman K and Futerman AH (2002) Do longevity assurance genes containing Hox domains regulate cell development via ceramide synthesis? FEBS Lett 528(1-3):3-4
Function/Process Non-Fungal Related Genes/Proteins Protein Sequence Features	Venkataraman K, et al. (2002) Upstream of growth and differentiation factor 1 (uog1), a mammalian homolog of the yeast longevity assurance gene 1 (LAG1), regulates N-stearoyl-sphinganine (C18-(dihydro)ceramide) synthesis in a fumonisin B1-independent manner in mammalian cells. J Biol Chem 277(38):35642-9	|LAC1
Reviews	Winter E and Ponting CP (2002) TRAM, LAG1 and CLN8: members of a novel family of lipid-sensing domains? Trends Biochem Sci 27(8):381-3
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Guillas I, et al. (2001) C26-CoA-dependent ceramide synthesis of Saccharomyces cerevisiae is operated by Lag1p and Lac1p. EMBO J 20(11):2655-65	|LAC1
Reviews	Jazwinski SM (2001) New clues to old yeast. Mech Ageing Dev 122(9):865-82	|LAC1
Function/Process Non-Fungal Related Genes/Proteins	Pan H, et al. (2001) Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1. Genomics 77(1-2):58-64
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Schorling S, et al. (2001) Lag1p and Lac1p are essential for the Acyl-CoA-dependent ceramide synthase reaction in Saccharomyces cerevisae. Mol Biol Cell 12(11):3417-27	|LAC1 |YDC1 |YPC1
Function/Process Non-Fungal Related Genes/Proteins	Brandwagt BF, et al. (2000) A longevity assurance gene homolog of tomato mediates resistance to Alternaria alternata f. sp. lycopersici toxins and fumonisin B1. Proc Natl Acad Sci U S A 97(9):4961-6
Reviews	Jazwinski SM (2000) Metabolic control and ageing. Trends Genet 16(11):506-11	|LAC1 |RTG1 |RTG2 |RTG3
Reviews	Powell CD, et al. (2000) Replicative ageing and senescence in Saccharomyces cerevisiae and the impact on brewing fermentations. Microbiology 146 ( Pt 5):1023-34	|LAG2 |PHB1 |RAS1 |RAS2 |SGS1 |SIR2 |SIR3 |SIR4
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features	Barz WP and Walter P (1999) Two endoplasmic reticulum (ER) membrane proteins that facilitate ER-to-Golgi transport of glycosylphosphatidylinositol-anchored proteins. Mol Biol Cell 10(4):1043-59	|LAC1
Reviews	Jazwinski SM (1999) Molecular mechanisms of yeast longevity. Trends Microbiol 7(6):247-52	|RAS1 |RAS2 |RTG1 |RTG2 |RTG3 |SIR4
Reviews	Sinclair DA (1999) Yeast aging research: recent advances and medical relevance. Cell Mol Life Sci 56(9-10):807-16	|LAC1 |LAG2 |RAS2 |RTG2 |SGS1 |SIR2 |SIR3 |SIR4
Cross-species Expression Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins	Jiang JC, et al. (1998) Homologs of the yeast longevity gene LAG1 in Caenorhabditis elegans and human. Genome Res 8(12):1259-72	|LAC1
Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features	Sinclair D, et al. (1998) Aging in Saccharomyces cerevisiae. Annu Rev Microbiol 52:533-60	|LAG2
Reviews	Sinclair DA, et al. (1998) Molecular mechanisms of yeast aging. Trends Biochem Sci 23(4):131-4	|LAG2 |SGS1 |SIR4
Reviews	Austriaco NR Jr (1996) Review: to bud until death: the genetics of ageing in the yeast, Saccharomyces. Yeast 12(7):623-30	|PHB1 |PHB2 |RAS2 |SIR4 |UTH1
Reviews	Jazwinski SM (1996) Longevity, genes, and aging. Science 273(5271):54-9	|LAC1 |PHB1 |PHB2
Reviews	Kennedy BK and Guarente L (1996) Genetic analysis of aging in Saccharomyces cerevisiae. Trends Genet 12(9):355-9	|SIR4
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features RNA Levels and Processing Strains/Constructs Transcription	D'mello NP, et al. (1994) Cloning and characterization of LAG1, a longevity-assurance gene in yeast. J Biol Chem 269(22):15451-9	|BCY1
Other Features	Jazwinski SM (1993) The genetics of aging in the yeast Saccharomyces cerevisiae. Genetica 91(1-3):35-51

Return to SGD

Send a Message to the SGD Curators