---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SCS2/YER120W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrV: 401131 to 401865 CDS: 401131 - 401865 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SCS2	YER120W		ORF, Verified	S000000922
Description
Integral ER membrane protein that regulates phospholipid metabolism via an interaction with the FFAT motif of Opi1p, also involved in telomeric silencing, disruption causes inositol auxotrophy above 34 degrees C, VAP homolog

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By FFAT motif binding Loewen CJ, et al. (2003) A conserved ER targeting motif in three families of lipid binding proteins and in Opi1p binds VAP. EMBO J 22(9):2025-35            IPI : Inferred from Physical Interaction with SGD:OPI1 IMP : Inferred from Mutant Phenotype Assigned on 2007-04-09 SGD phosphoinositide binding Kagiwada S and Hashimoto M (2007) The yeast VAP homolog Scs2p has a phosphoinositide-binding ability that is correlated with its activity. Biochem Biophys Res Commun 364(4):870-6        IDA : Inferred from Direct Assay Assigned on 2007-11-30 SGD structural molecule activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000535 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By ER-nuclear signaling pathway Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT chromatin silencing at telomere Craven RJ and Petes TD (2001) The Saccharomyces cerevisiae suppressor of choline sensitivity (SCS2) gene is a multicopy Suppressor of mec1 telomeric silencing defects. Genetics 158(1):145-54        IGI : Inferred from Genetic Interaction with SGD:MEC1, SGD:DUN1 IMP : Inferred from Mutant Phenotype Assigned on 2007-05-17 SGD Cuperus G and Shore D (2002) Restoration of silencing in Saccharomyces cerevisiae by tethering of a novel Sir2-interacting protein, Esc8. Genetics 162(2):633-45        IGI : Inferred from Genetic Interaction with SGD:SIR2 Assigned on 2007-05-16 SGD endoplasmic reticulum inheritance Loewen CJ, et al. (2007) Inheritance of cortical ER in yeast is required for normal septin organization. J Cell Biol 179(3):467-83        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction with SGD:ICE2 Assigned on 2008-09-30 SGD negative regulation of transcription factor import into nucleus Loewen CJ, et al. (2003) A conserved ER targeting motif in three families of lipid binding proteins and in Opi1p binds VAP. EMBO J 22(9):2025-35            IPI : Inferred from Physical Interaction with SGD:OPI1 IMP : Inferred from Mutant Phenotype Assigned on 2007-05-04 SGD phospholipid biosynthetic process Nikawa J, et al. (1995) Cloning and sequence of the SCS2 gene, which can suppress the defect of INO1 expression in an inositol auxotrophic mutant of Saccharomyces cerevisiae. J Biochem 118(1):39-45      IGI : Inferred from Genetic Interaction with SGD:HAC1 Assigned on 2007-05-15 SGD Kagiwada S, et al. (1998) The Saccharomyces cerevisiae SCS2 gene product, a homolog of a synaptobrevin-associated protein, is an integral membrane protein of the endoplasmic reticulum and is required for inositol metabolism. J Bacteriol 180(7):1700-8        IMP : Inferred from Mutant Phenotype Assigned on 2007-05-15 SGD Kagiwada S and Zen R (2003) Role of the yeast VAP homolog, Scs2p, in INO1 expression and phospholipid metabolism. J Biochem 133(4):515-22        IMP : Inferred from Mutant Phenotype Assigned on 2007-05-16 SGD regulation of intracellular lipid transport Loewen CJ, et al. (2003) A conserved ER targeting motif in three families of lipid binding proteins and in Opi1p binds VAP. EMBO J 22(9):2025-35            IMP : Inferred from Mutant Phenotype Assigned on 2007-05-08 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cellular bud tip Loewen CJ, et al. (2007) Inheritance of cortical ER in yeast is required for normal septin organization. J Cell Biol 179(3):467-83        IDA : Inferred from Direct Assay Assigned on 2008-09-30 SGD endoplasmic reticulum Loewen CJ, et al. (2003) A conserved ER targeting motif in three families of lipid binding proteins and in Opi1p binds VAP. EMBO J 22(9):2025-35            IDA : Inferred from Direct Assay Assigned on 2007-04-11 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to endoplasmic reticulum membrane Kagiwada S, et al. (1998) The Saccharomyces cerevisiae SCS2 gene product, a homolog of a synaptobrevin-associated protein, is an integral membrane protein of the endoplasmic reticulum and is required for inositol metabolism. J Bacteriol 180(7):1700-8        IDA : Inferred from Direct Assay Assigned on 2008-02-25 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9908 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB nuclear envelope Loewen CJ, et al. (2003) A conserved ER targeting motif in three families of lipid binding proteins and in Opi1p binds VAP. EMBO J 22(9):2025-35            IDA : Inferred from Direct Assay Assigned on 2007-04-11 SGD nuclear membrane Kagiwada S, et al. (1998) The Saccharomyces cerevisiae SCS2 gene product, a homolog of a synaptobrevin-associated protein, is an integral membrane protein of the endoplasmic reticulum and is required for inositol metabolism. J Bacteriol 180(7):1700-8        IDA : Inferred from Direct Assay Assigned on 2007-05-04 SGD nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for SCS2/YER120W for SCS2 SCS2 encodes a type II integral membrane protein and VAP (VAMP/synaptobrevin-associated protein) family member that localizes to both the endoplasmic reticulum (ER) and nuclear membranes (1, 2) where it regulates intracellular lipid traffic and phospholipid biosynthesis (2). A region of Scs2p that is conserved in VAP family members constitutes the binding site for a short membrane-targeting determinant called the FFAT motif (two phenylalanines (FF) in an Acidic Tract). The FFAT motif is located in several sterol-binding proteins involved in intracellular sterol transport (Swh1p, Osh2p and Osh3p) and in a transcriptional corepressor of phospholipid biosynthetic genes (Opi1p) (3, 2). Interactions between Scs2p and the sterol-binding proteins regulate intracellular lipid transport by targeting these proteins to the ER membrane, the site of synthesis for most lipids (2). Under conditions where inositol is limiting and the unfolded protein response (UPR) activated, direct interactions between Scs2p and Opi1p sequester this transcriptional regulator at the ER/nuclear membrane where it can then bind to phosphatidic acid (PA) (2, 4, 5). Upon the addition of inositol, the lipid precursor phosphatidic acid (PA) and cytidyldiphosphate diacylglycerol (CDP-DAG) are converted into phosphatidylinositol (PI), resulting in the consumption of PA, and the release of Opi1p from the membrane followed by its nuclear translocation (reviewed in 6). Thus by regulating the intracellular location of this lipid-sensing transcriptional regulator, Scs2p regulates the negative feedback loop that controls expression of inositol biosynthetic genes. Scs2p also directly regulates the intranuclear localization of the gene encoding inositol 1-phosphate synthase (INO1), the rate-limiting enzyme in inositol biosynthesis (4). SCS2 was originally identified as a suppressor of the inositol auxotrophy associated with a dominant choline sensitive mutant (7) and with hac1 mutants, both of which are also defective for expression of INO1 (8). scs2 deletion mutants have reduced levels of phosphatidylinositol, increased levels of phophatidylcholine and a leaky inositol auxotrophy when cultured at elevated temperatures (1, 9). The leaky inositol auxotrophy is suppressed by overexpression of INO1 or INO2, or by deletion of genes in the CDP-choline pathway (CKI1, PCT1, and CPT1), a pathway that is upregulated in scs2 deletion mutants (1, 9). Deletion of SCS22, an SCS2-like gene, does not result in inositol auxotrophy but does contribute to the regulation of phospholipid metabolism, as the phenotype associated with the double mutant is more severe than that of an scs2 single mutant (3). SCS2 has also been identified as a multicopy suppressor of strains with telomere silencing defects (10, 11), while deletion of SCS2 results in a loss of telomeric silencing (10). SCS2 has sequence similarity with members of the VAP protein family including the founding member, VAP-33, an Aplysia gene required for neurotransmitter release (reviewed in 12). Three human VAP family members VAP-A (OMIM), VAP-B (OMIM) and VAP-C (OMIM) (a VAP-B splicing variant) (13) are also involved in recruiting FFAT-motif containing lipid-binding proteins to the ER (14, 3). Human VAP family members have also been implicated in both vesicular trafficking and organization of microtubule networks (references found within 15). The human VAP-A gene can partially complement the function of yeast VAPs by rescuing the inositol auxotrophy of an scs2 scs22 double mutant under less stringent conditions, and this rescue is dependent upon the integrity of the FFAT-binding region of VAP-A (3). Mutations in the human VAP-B gene cause atypical amyotrophic lateral sclerosis (ALS) type 8 (a neurodegenerative disease also known as Lou Gehrig's disease; OMIM), and late-onset spinal muscular atrophy (SMA) (OMIM) (16). Last Updated: 2007-06-01

Basic References [TOP]

BASIC INFORMATION REFERENCES forSCS2/YER120W for SCS2 1) Kagiwada S, et al. (1998) The Saccharomyces cerevisiae SCS2 gene product, a homolog of a synaptobrevin-associated protein, is an integral membrane protein of the endoplasmic reticulum and is required for inositol metabolism. J Bacteriol 180(7):1700-8        2) Loewen CJ, et al. (2003) A conserved ER targeting motif in three families of lipid binding proteins and in Opi1p binds VAP. EMBO J 22(9):2025-35            3) Loewen CJ and Levine TP (2005) A highly conserved binding site in vesicle-associated membrane protein-associated protein (VAP) for the FFAT motif of lipid-binding proteins. J Biol Chem 280(14):14097-104        4) Brickner JH and Walter P (2004) Gene recruitment of the activated INO1 locus to the nuclear membrane. PLoS Biol 2(11):e342              5) Loewen CJ, et al. (2004) Phospholipid metabolism regulated by a transcription factor sensing phosphatidic acid. Science 304(5677):1644-7        6) Chen M, et al. (2007) Transcriptional regulation of yeast phospholipid biosynthetic genes. Biochim Biophys Acta 1771(3):310-21        7) Hosaka K, et al. (1994) Cloning and characterization of the SCS1 gene required for the expression of genes in yeast phospholipid synthesis. J Biochem 115(1):131-6      8) Nikawa J, et al. (1995) Cloning and sequence of the SCS2 gene, which can suppress the defect of INO1 expression in an inositol auxotrophic mutant of Saccharomyces cerevisiae. J Biochem 118(1):39-45      9) Kagiwada S and Zen R (2003) Role of the yeast VAP homolog, Scs2p, in INO1 expression and phospholipid metabolism. J Biochem 133(4):515-22        10) Craven RJ and Petes TD (2001) The Saccharomyces cerevisiae suppressor of choline sensitivity (SCS2) gene is a multicopy Suppressor of mec1 telomeric silencing defects. Genetics 158(1):145-54        11) Cuperus G and Shore D (2002) Restoration of silencing in Saccharomyces cerevisiae by tethering of a novel Sir2-interacting protein, Esc8. Genetics 162(2):633-45        12) Gerst JE (1999) SNAREs and SNARE regulators in membrane fusion and exocytosis. Cell Mol Life Sci 55(5):707-34      13) Nishimura Y, et al. (1999) Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins. Biochem Biophys Res Commun 254(1):21-6          14) Wyles JP and Ridgway ND (2004) VAMP-associated protein-A regulates partitioning of oxysterol-binding protein-related protein-9 between the endoplasmic reticulum and Golgi apparatus. Exp Cell Res 297(2):533-47          15) Kaiser SE, et al. (2005) Structural basis of FFAT motif-mediated ER targeting. Structure 13(7):1035-45        16) Nishimura AL, et al. (2004) A mutation in the vesicle-trafficking protein VAPB causes late-onset spinal muscular atrophy and amyotrophic lateral sclerosis. Am J Hum Genet 75(5):822-31

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SCS2/YER120W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SCS2/YER120W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSAVEIS C-term VLGWFYR Length(aa) 244 MW(Da) 26,925 pI 4.67 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.270   Codon Adaptation Index 0.194   Frequency of Optimal Codons 0.579   Hydropathicity of Protein -0.295   Aromaticity Score 0.066	10 20 30 40 50 | | | | | MSAVEISPDVLVYKSPLTEQSTEYASISNNSDQTIAFKVKTTAPKFYCVR PNAAVVAPGETIQVQVIFLGLTEEPAADFKCRDKFLVITLPSPYDLNGKA VADVWSDLEAEFKQQAISKKIKVKYLISPDVHPAQNQNIQENKETVEPVV QDSEPKEVPAVVNEKEVPAEPETQPPVQVKKEEVPPVVQKTVPHENEKQT SNSTPAPQNQIKEAATVPAENESSSMGIFILVALLILVLGWFYR*

Protein Structures from PDB: proteins of known structure with sequence similarity to SCS2/YER120W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to SCS2 Homolog Source (per PDB) Protein Alignment: SCS2 vs. Homolog External Links P-Value %Identical %Similar Alignment 1z9o ( Chain: F, C, D, E, A, B) .9 angstrom crystal structure of the rat vap-a msp homology domain in complex with the rat orp1 ffat motif PDB_Info PDB_Structure Rattus norvegicus Chain F = 4.4e-10 37 31 View alignment SCOP MMDB CATH Chain C = 4.4e-10 37 31 View alignment Chain D = 4.4e-10 37 31 View alignment Chain E = 4.4e-10 37 31 View alignment Chain A = 4.4e-10 37 31 View alignment Chain B = 4.4e-10 37 31 View alignment 1z9l ( Chain: A) .7 angstrom crystal structure of the rat vap-a msp homology domain PDB_Info PDB_Structure Rattus norvegicus 4.4e-10 37 31 View alignment SCOP MMDB CATH 2cri ( Chain: A) Solution structure of the msp domain of mouse vamp- associated proteina PDB_Info PDB_Structure Mus musculus 6.2e-10 36 32 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SCS2	Nikawa J, et al. (1995) Cloning and sequence of the SCS2 gene, which can suppress the defect of INO1 expression in an inositol auxotrophic mutant of Saccharomyces cerevisiae. J Biochem 118(1):39-45

Mapping Notes

Date	Note
1996-09-21	Edition 13: isolated as suppressor of a dominant nuclear mutation CSE1 (not gene of same name on chr VII) that is inositol-dependent in the presence of choline Cherry JM, et al. (1996) "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 13)". Pp. 361-364 in 1996 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YER120W	SGD Systematic Sequence
856856	NCBI: Gene ID
NP_011046.1	NCBI: RefSeq protein version ID
NP_011046.1	NCBI: RefSeq protein version ID
6320966	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
40 curated references; 0 references not yet curated
Techniques and Reagents	Chao JT, et al. (2009) Identification of protein complexes with quantitative proteomics in S. cerevisiae. J Vis Exp(25)
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Fernandez-Murray JP, et al. (2009) NTE1-encoded phosphatidylcholine phospholipase b regulates transcription of phospholipid biosynthetic genes. J Biol Chem 284(52):36034-46	|BCK1 |CHO1 |HAC1 |HNM1 |IES6 |INO1 |INO80 |IRE1 |NTE1 |OPI1 |PCT1 |SCS22 |SCS3 |SLT2 |MORE
Reviews	Nohturfft A and Zhang SC (2009) Coordination of lipid metabolism in membrane biogenesis. Annu Rev Cell Dev Biol 25:539-66	|DGK1 |ECM22 |HAP1 |INO2 |INO4 |MOT3 |OPI1 |PAH1 |UPC2 |YER064C
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Zou J, et al. (2009) Regulation of cell polarity through phosphorylation of Bni4 by Pho85 G1 cyclin-dependent kinases in Saccharomyces cerevisiae. Mol Biol Cell 20(14):3239-50	|AIM44 |APL3 |AXL1 |BCK1 |BEM1 |BEM2 |BNI1 |BNI4 |BNR1 |BOI1 |BOP3 |BUD22 |BUD3 |BUD4 |MORE
Genetic Interactions	Addinall SG, et al. (2008) A Genomewide Suppressor and Enhancer Analysis of cdc13-1 Reveals Varied Cellular Processes Influencing Telomere Capping in Saccharomyces cerevisiae. Genetics 180(4):2251-66	|APQ12 |ARC18 |ARV1 |ASC1 |ASE1 |BFA1 |BIM1 |BMH1 |BRE2 |BUB1 |BUB2 |BUB3 |BUD27 |CCS1 |MORE
Fungal Related Genes/Proteins	Kobayashi S, et al. (2008) Disruption of the SCS2 ortholog in the alkane-assimilating yeast Yarrowia lipolytica impairs its growth on n-decane, but does not impair inositol prototrophy. Biosci Biotechnol Biochem 72(8):2219-23
Disease Gene Related Non-Fungal Related Genes/Proteins Reviews	Lev S, et al. (2008) The VAP protein family: from cellular functions to motor neuron disease. Trends Cell Biol 18(6):282-90
Cellular Location Regulation of Strains/Constructs	Schuldiner M, et al. (2008) The GET complex mediates insertion of tail-anchored proteins into the ER membrane. Cell 134(4):634-45	|BOS1 |GET1 |GET2 |GET3 |GOS1 |KAR2 |PEP12 |PEX15 |SBH1 |SBH2 |SEC22 |SED5 |TLG2 |UBC6 |MORE
Reviews	Carman GM and Henry SA (2007) Phosphatidic acid plays a central role in the transcriptional regulation of glycerophospholipid synthesis in Saccharomyces cerevisiae. J Biol Chem 282(52):37293-7	|INO2 |INO4 |OPI1 |PAH1 |SEC14
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Kagiwada S and Hashimoto M (2007) The yeast VAP homolog Scs2p has a phosphoinositide-binding ability that is correlated with its activity. Biochem Biophys Res Commun 364(4):870-6
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features	Loewen CJ, et al. (2007) Inheritance of cortical ER in yeast is required for normal septin organization. J Cell Biol 179(3):467-83	|AXL2 |BEM2 |BEM3 |BIM1 |BNI1 |BUD3 |BUD6 |CDC10 |CLA4 |HSL7 |ICE2 |MIH1 |MSB3 |MSB4 |MORE
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Reviews	Howe AG and McMaster CR (2006) Regulation of phosphatidylcholine homeostasis by Sec14. Can J Physiol Pharmacol 84(1):29-38	|CHO2 |CKI1 |CPT1 |EPT1 |INO1 |NTE1 |OPI1 |OPI3 |PCT1 |PLB1 |SEC14 |SPO14
Genetic Interactions	Tabuchi M, et al. (2006) The phosphatidylinositol 4,5-biphosphate and TORC2 binding proteins Slm1 and Slm2 function in sphingolipid regulation. Mol Cell Biol 26(15):5861-75	|AUR1 |BCK1 |CMP2 |CNB1 |CSG2 |FEN1 |GAS1 |GIM3 |INO2 |INO4 |ISC1 |KRE1 |LDB16 |MSS4 |MORE
Protein Processing/Modification/Regulation Techniques and Reagents	Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48	|AAC1 |AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |MORE
Infection and Antifungals Mutants/Phenotypes Strains/Constructs	Cowen LE and Lindquist S (2005) Hsp90 potentiates the rapid evolution of new traits: drug resistance in diverse fungi. Science 309(5744):2185-9	|CKA2 |CNA1 |CNB1 |CPR1 |ERG3 |ERG6 |HSC82 |LCL1 |PDR1 |PDR5 |RTC2 |YGR283C |YLR407W |YMR099C |MORE
DNA/RNA Sequence Features	Duttagupta R, et al. (2005) Global analysis of Pub1p targets reveals a coordinate control of gene expression through modulation of binding and stability. Mol Cell Biol 25(13):5499-513	|ANT1 |APM1 |BGL2 |DED1 |FZO1 |GCN4 |HYP2 |MRH1 |OST3 |PAB1 |PCL5 |PRB1 |PUB1 |RPL14B |MORE
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions Strains/Constructs	Kaiser SE, et al. (2005) Structural basis of FFAT motif-mediated ER targeting. Structure 13(7):1035-45	|OPI1
Cross-species Expression Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Loewen CJ and Levine TP (2005) A highly conserved binding site in vesicle-associated membrane protein-associated protein (VAP) for the FFAT motif of lipid-binding proteins. J Biol Chem 280(14):14097-104	|OPI1 |SCS22
Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Regulatory Role Strains/Constructs	Brickner JH and Walter P (2004) Gene recruitment of the activated INO1 locus to the nuclear membrane. PLoS Biol 2(11):e342	|HAC1 |INO1 |INO2 |INO4 |OPI1
Protein-protein Interactions	Daum G (2004) Membrane targeting: glued by a lipid to the ER. Curr Biol 14(17):R711-3	|OPI1
Reviews	Du Y, et al. (2004) Dynamics and inheritance of the endoplasmic reticulum. J Cell Sci 117(Pt 14):2871-8	|ICE2 |MYO4 |SHE3 |SWA2 |YPT11
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs Substrates/Ligands/Cofactors	Loewen CJ, et al. (2004) Phospholipid metabolism regulated by a transcription factor sensing phosphatidic acid. Science 304(5677):1644-7	|OPI1 |PIS1 |SPO14
Disease Gene Related Non-Fungal Related Genes/Proteins	Nishimura AL, et al. (2004) A mutation in the vesicle-trafficking protein VAPB causes late-onset spinal muscular atrophy and amyotrophic lateral sclerosis. Am J Hum Genet 75(5):822-31
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Protein Processing/Modification/Regulation Regulation of	Zhou W, et al. (2004) Global analyses of sumoylated proteins in Saccharomyces cerevisiae. Induction of protein sumoylation by cellular stresses. J Biol Chem 279(31):32262-8	|ABF1 |ADH1 |ADH2 |AOS1 |BIR1 |CDC11 |CDC19 |CDC3 |CDC48 |EFT2 |ENO1 |FBA1 |GCD7 |GPM1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Anderson JB, et al. (2003) Mode of selection and experimental evolution of antifungal drug resistance in Saccharomyces cerevisiae. Genetics 163(4):1287-98	|CKA2 |ERG11 |ERG28 |ERG3 |ERG6 |LCL1 |PDR1 |PDR5 |RTC2 |SML1 |SNQ2 |SWH1 |YGR283C |YLR407W |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs	Kagiwada S and Zen R (2003) Role of the yeast VAP homolog, Scs2p, in INO1 expression and phospholipid metabolism. J Biochem 133(4):515-22	|INO1
Mutants/Phenotypes Strains/Constructs	Kushner DB, et al. (2003) Systematic, genome-wide identification of host genes affecting replication of a positive-strand RNA virus. Proc Natl Acad Sci U S A 100(26):15764-9	|ACB1 |ALF1 |AML1 |BRO1 |BUB1 |BUD26 |BUD31 |CBC2 |CDC50 |DBR1 |DED1 |DHH1 |DOA1 |DOA4 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Loewen CJ, et al. (2003) A conserved ER targeting motif in three families of lipid binding proteins and in Opi1p binds VAP. EMBO J 22(9):2025-35	|OPI1 |OSH2 |OSH3 |SWH1
Regulation of Transcription	Zhang W, et al. (2003) Microarray analyses of the metabolic responses of Saccharomyces cerevisiae to organic solvent dimethyl sulfoxide. J Ind Microbiol Biotechnol 30(1):57-69	|AAH1 |ABP140 |ACS2 |ADE1 |ADE12 |ADE17 |ADE4 |ADE8 |ADH2 |ADH4 |ADH5 |ADK1 |ADO1 |ALD3 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes	Cuperus G and Shore D (2002) Restoration of silencing in Saccharomyces cerevisiae by tethering of a novel Sir2-interacting protein, Esc8. Genetics 162(2):633-45	|ESC2 |ESC8 |GAL11 |IOC3 |ISW1 |SIR2
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Craven RJ and Petes TD (2001) The Saccharomyces cerevisiae suppressor of choline sensitivity (SCS2) gene is a multicopy Suppressor of mec1 telomeric silencing defects. Genetics 158(1):145-54	|MEC1 |SCS22 |TEL1
Reviews	Gerst JE (1999) SNAREs and SNARE regulators in membrane fusion and exocytosis. Cell Mol Life Sci 55(5):707-34	|DDI1 |SEC1 |SEC17 |SEC18 |SEC4 |SEC9 |SNC1 |SNC2 |SSO1 |SSO2 |YPT1
Non-Fungal Related Genes/Proteins	Nishimura Y, et al. (1999) Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins. Biochem Biophys Res Commun 254(1):21-6	|SCS22
Non-Fungal Related Genes/Proteins	Soussan L, et al. (1999) ERG30, a VAP-33-related protein, functions in protein transport mediated by COPI vesicles. J Cell Biol 146(2):301-11
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Kagiwada S, et al. (1998) The Saccharomyces cerevisiae SCS2 gene product, a homolog of a synaptobrevin-associated protein, is an integral membrane protein of the endoplasmic reticulum and is required for inositol metabolism. J Bacteriol 180(7):1700-8	|CSE1 |HAC1 |INO1
DNA/RNA Sequence Features Function/Process Genetic Interactions Mutants/Phenotypes Protein Physical Properties Regulatory Role Strains/Constructs	Nikawa J, et al. (1995) Cloning and sequence of the SCS2 gene, which can suppress the defect of INO1 expression in an inositol auxotrophic mutant of Saccharomyces cerevisiae. J Biochem 118(1):39-45	|HAC1 |INO1 |INO2 |SCS22
Genetic Interactions Strains/Constructs	Hosaka K, et al. (1994) Cloning and characterization of the SCS1 gene required for the expression of genes in yeast phospholipid synthesis. J Biochem 115(1):131-6	|CHO2 |INO1 |INO2 |OPI3
Genetic Interactions	Hosaka K, et al. (1994) Cloning and sequence of the SCS3 gene which is required for inositol prototrophy in Saccharomyces cerevisiae. J Biochem 116(6):1317-21	|SCS3

Return to SGD

Send a Message to the SGD Curators