---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

GLE2/YER107C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrV: 374541 to 373444 CDS: 374541 - 373444 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
GLE2	YER107C	RAE1	ORF, Verified	S000000909
Description
Component of the Nup82 subcomplex of the nuclear pore complex; required for polyadenylated RNA export but not for protein import; homologous to S. pombe Rae1p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear envelope organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD translational termination Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Nup82 complex Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51        IDA : Inferred from Direct Assay Assigned on 2009-10-14 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for GLE2/YER107C for GLE2 GLE2 encodes a nuclear pore protein homologous to the nucleoporin Rae1p identified in S. pombe and mammalian cells (1, 2, 3, 4). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 4, 5, 6, 7). The structure of the vertebrate NPC has been studied extensively; recent reviews include 8, 9, 10, and 11. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (12, 13). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 4, 5, 14, 15, 16). GLE2 was identified by a mutation that is synthetically lethal with a nup100 null mutation (2), and interacts genetically with genes encoding other nucleoporins and nuclear transport factors (17). Gle2p forms a stable complex with the nucleoporin Nup116p (18, 19); binding to Nup116p is required for Gle2p to associate with nuclear pores (19). Gle2p also associates with the nuclear localization signal receptor Srp1p and Nup42p, which interacts with nuclear export signals. Mutations in GLE2 block export of polyadenylated RNA from the nucleus, and cause defects in NPC and nuclear envelope structure (2). Last Updated: 1999-08-05

Basic References [TOP]

BASIC INFORMATION REFERENCES forGLE2/YER107C for GLE2 1) Kraemer D and Blobel G (1997) mRNA binding protein mrnp 41 localizes to both nucleus and cytoplasm. Proc Natl Acad Sci U S A 94(17):9119-24        2) Murphy R, et al. (1996) GLE2, a Saccharomyces cerevisiae homologue of the Schizosaccharomyces pombe export factor RAE1, is required for nuclear pore complex structure and function. Mol Biol Cell 7(12):1921-37      3) Pritchard CE, et al. (1999) RAE1 is a shuttling mRNA export factor that binds to a GLEBS-like NUP98 motif at the nuclear pore complex through multiple domains. J Cell Biol 145(2):237-54        4) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      5) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    6) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      7) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      8) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      9) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      10) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      11) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      12) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      13) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        14) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      15) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        16) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      17) Ho AK, et al. (1998) The integral membrane protein snl1p is genetically linked to yeast nuclear pore complex function. Mol Biol Cell 9(2):355-73        18) Iovine MK and Wente SR (1997) A nuclear export signal in Kap95p is required for both recycling the import factor and interaction with the nucleoporin GLFG repeat regions of Nup116p and Nup100p. J Cell Biol 137(4):797-811        19) Bailer SM, et al. (1998) Nup116p and nup100p are interchangeable through a conserved motif which constitutes a docking site for the mRNA transport factor gle2p. EMBO J 17(4):1107-19        20) Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51        21) Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GLE2/YER107C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GLE2/YER107C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSFFNRS C-term VKEKKKR Length(aa) 365 MW(Da) 40,522 pI 8.49 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.075   Codon Adaptation Index 0.109   Frequency of Optimal Codons 0.363   Hydropathicity of Protein -0.483   Aromaticity Score 0.096	10 20 30 40 50 | | | | | MSFFNRSNTTSALGTSTAMANEKDLANDIVINSPAEDSISDIAFSPQQDF MFSASSWDGKVRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGC DNALKLYDIASGQTQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIK YWDMRQPQPVSTVMMPERVYSMDNKQSLLVVATAERHIAIINLANPTTIF KATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSGFSFK CHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQ RHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVIR LHATTDEEVKEKKKR*

Protein Structures from PDB: proteins of known structure with sequence similarity to GLE2/YER107C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to GLE2 Homolog Source (per PDB) Protein Alignment: GLE2 vs. Homolog External Links P-Value %Identical %Similar Alignment 2i3t ( Chain: A, G, C, E) Bub3 complex with mad3 (bubr1) glebs motif PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 3.3e-16 26 32 View alignment SCOP MMDB CATH Chain G = 3.3e-16 26 32 View alignment Chain C = 3.3e-16 26 32 View alignment Chain E = 3.3e-16 26 32 View alignment 1yfq ( Chain: A) High resolution s. cerevisiae bub3 mitotic checkpoint protein PDB_Info PDB_Structure Saccharomyces cerevisiae 3.3e-16 26 32 View alignment SCOP MMDB CATH 2i3s ( Chain: A, E, C) Bub3 complex with bub1 glebs motif PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 3.3e-16 26 32 View alignment SCOP MMDB CATH Chain E = 3.3e-16 26 32 View alignment Chain C = 3.3e-16 26 32 View alignment 1u4c ( Chain: A, B) Structure of spindle checkpoint protein bub3 PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 3.3e-16 26 32 View alignment SCOP MMDB CATH Chain B = 3.3e-16 26 32 View alignment 1erj ( Chain: C, A, B) Crystal structure of the c-terminal wd40 domain of tup1 PDB_Info PDB_Structure Saccharomyces cerevisiae Chain C = 1.1e-07 24 31 View alignment SCOP MMDB CATH Chain A = 1.1e-07 24 31 View alignment Chain B = 1.1e-07 24 31 View alignment 2zkq ( Chain: a) Structure of a mammalian ribosomal 40s subunit within an 80s complex obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map PDB_Info PDB_Structure Canis familiaris 6.3e-07 33 34 View alignment SCOP MMDB CATH 2g99 ( Chain: B, A) Structural basis for the specific recognition of methylated histone h3 lysine 4 by the wd-40 protein wdr5 PDB_Info PDB_Structure Homo sapiens Chain B = 1.8e-06 21 36 View alignment SCOP MMDB CATH Chain A = 1.8e-06 21 36 View alignment 2g9a ( Chain: A) Structural basis for the specific recognition of methylated histone h3 lysine 4 by the wd-40 protein wdr5 PDB_Info PDB_Structure Homo sapiens 1.8e-06 21 36 View alignment SCOP MMDB CATH 2h6k ( Chain: A, B) Histone h3 recognition and presentation by the wdr5 module of the mll1 complex PDB_Info PDB_Structure Homo sapiens Chain A = 1.8e-06 21 36 View alignment SCOP MMDB CATH Chain B = 1.8e-06 21 36 View alignment 2h68 ( Chain: B, A) Histone h3 recognition and presentation by the wdr5 module of the mll1 complex PDB_Info PDB_Structure Homo sapiens Chain B = 1.8e-06 21 36 View alignment SCOP MMDB CATH Chain A = 1.8e-06 21 36 View alignment 2h6q ( Chain: A, B) Histone h3 recognition and presentation by the wdr5 module of the mll1 complex PDB_Info PDB_Structure Homo sapiens Chain A = 1.8e-06 21 36 View alignment SCOP MMDB CATH Chain B = 1.8e-06 21 36 View alignment 2h6n ( Chain: B, A) Histone h3 recognition and presentation by the wdr5 module of the mll1 complex PDB_Info PDB_Structure Homo sapiens Chain B = 1.8e-06 21 36 View alignment SCOP MMDB CATH Chain A = 1.8e-06 21 36 View alignment 3eg6 ( Chain: A) Structure of wdr5 bound to mll1 peptide PDB_Info PDB_Structure Homo sapiens 1.8e-06 21 36 View alignment SCOP MMDB CATH 2h9m ( Chain: C, A) Wdr5 in complex with unmodified h3k4 peptide PDB_Info PDB_Structure Homo sapiens Chain C = 1.8e-06 21 36 View alignment SCOP MMDB CATH Chain A = 1.8e-06 21 36 View alignment 2h9n ( Chain: C, A) Wdr5 in complex with monomethylated h3k4 peptide PDB_Info PDB_Structure Homo sapiens Chain C = 1.8e-06 21 36 View alignment SCOP MMDB CATH Chain A = 1.8e-06 21 36 View alignment 2o9k ( Chain: C, A) Wdr5 in complex with dimethylated h3k4 peptide PDB_Info PDB_Structure Homo sapiens Chain C = 1.8e-06 21 36 View alignment SCOP MMDB CATH Chain A = 1.8e-06 21 36 View alignment 2h14 ( Chain: A) Crystal of wdr5 (apo-form) PDB_Info PDB_Structure Homo sapiens 2.0e-06 21 36 View alignment SCOP MMDB CATH 2h13 ( Chain: A) Crystal structure of wdr5/histone h3 complex PDB_Info PDB_Structure Homo sapiens 2.0e-06 21 36 View alignment SCOP MMDB CATH 3emh ( Chain: A) Structural basis of wdr5-mll interaction PDB_Info PDB_Structure Homo sapiens 2.0e-06 21 36 View alignment SCOP MMDB CATH 2h9p ( Chain: A) Wdr5 in complex with trimethylated h3k4 peptide PDB_Info PDB_Structure Homo sapiens 2.0e-06 21 36 View alignment SCOP MMDB CATH 2h9l ( Chain: A) Wdr5delta23 PDB_Info PDB_Structure Homo sapiens 2.0e-06 21 36 View alignment SCOP MMDB CATH 2gnq ( Chain: A) Structure of wdr5 PDB_Info PDB_Structure Homo sapiens 2.0e-06 21 36 View alignment SCOP MMDB CATH 2cnx ( Chain: A) Wdr5 and histone h3 lysine 4 dimethyl complex at 2.1 angstrom PDB_Info PDB_Structure Homo sapiens 2.2e-06 21 36 View alignment SCOP MMDB CATH 2co0 ( Chain: A, C) Wdr5 and unmodified histone h3 complex at 2.25 angstrom PDB_Info PDB_Structure Homo sapiens Chain A = 2.2e-06 21 36 View alignment SCOP MMDB CATH Chain C = 2.2e-06 21 36 View alignment 3dm0 ( Chain: A) Maltose binding protein fusion with rack1 from a. thaliana PDB_Info PDB_Structure Escherichia coli, arabidopsis thaliana 5.9e-06 23 32 View alignment SCOP MMDB CATH 1p22 ( Chain: A) Structure of a beta-trcp1-skp1-beta-catenin complex: destruction motif binding and lysine specificity on the scfbeta-trcp1 ubiquitin ligase PDB_Info PDB_Structure Homo sapiens 3.7e-05 27 28 View alignment SCOP MMDB CATH 2pbi ( Chain: D, B) The multifunctional nature of gbeta5/rgs9 revealed from its crystal structure PDB_Info PDB_Structure Mus musculus Chain D = 9.2e-05 29 31 View alignment SCOP MMDB CATH Chain B = 9.2e-05 29 31 View alignment 1vyh ( Chain: G, P, C, K, H, L, D, T, O, S) Paf-ah holoenzyme: lis1/alfa2 PDB_Info PDB_Structure Mus musculus | Homo sapiens Chain G = 0.000250 24 30 View alignment SCOP MMDB CATH Chain P = 0.000250 24 30 View alignment Chain C = 0.000250 24 30 View alignment Chain K = 0.000250 24 30 View alignment Chain H = 0.000250 24 30 View alignment Chain L = 0.000250 24 30 View alignment Chain D = 0.000250 24 30 View alignment Chain T = 0.000250 24 30 View alignment Chain O = 0.000250 24 30 View alignment Chain S = 0.000250 24 30 View alignment 2ce8 ( Chain: D, C, B, A) An eh1 peptide bound to the groucho-tle wd40 domain. PDB_Info PDB_Structure Homo sapiens Chain D = 0.000270 27 35 View alignment SCOP MMDB CATH Chain C = 0.000270 27 35 View alignment Chain B = 0.000270 27 35 View alignment Chain A = 0.000270 27 35 View alignment 1gxr ( Chain: A, B) Wd40 region of human groucho/tle1 PDB_Info PDB_Structure Homo sapiens Chain A = 0.000270 27 35 View alignment SCOP MMDB CATH Chain B = 0.000270 27 35 View alignment 2ce9 ( Chain: A, B, D, C) A wrpw peptide bound to the groucho-tle wd40 domain. PDB_Info PDB_Structure Homo sapiens Chain A = 0.000270 27 35 View alignment SCOP MMDB CATH Chain B = 0.000270 27 35 View alignment Chain D = 0.000270 27 35 View alignment Chain C = 0.000270 27 35 View alignment 2ovq ( Chain: B) Structure of the skp1-fbw7-cyclinedegc complex PDB_Info PDB_Structure Homo sapiens 0.000720 28 29 View alignment SCOP MMDB CATH 2ovr ( Chain: B) Structure of the skp1-fbw7-cyclinedegn complex PDB_Info PDB_Structure Homo sapiens 0.000720 28 29 View alignment SCOP MMDB CATH 2ovp ( Chain: B) Structure of the skp1-fbw7 complex PDB_Info PDB_Structure Homo sapiens 0.000720 28 29 View alignment SCOP MMDB CATH 3ei4 ( Chain: F, B, D) Structure of the hsddb1-hsddb2 complex PDB_Info PDB_Structure Homo sapiens Chain F = 0.001100 24 31 View alignment SCOP MMDB CATH Chain B = 0.001100 24 31 View alignment Chain D = 0.001100 24 31 View alignment 1trj ( Chain: A) Homology model of yeast rack1 protein fitted into 11.7a cryo-em map of yeast 80s ribosome PDB_Info PDB_Structure Saccharomyces cerevisiae 0.001999 20 34 View alignment SCOP MMDB CATH 3frx ( Chain: B, C, A, D) Crystal structure of the yeast orthologue of rack1, asc1. PDB_Info PDB_Structure Saccharomyces cerevisiae Chain B = 0.002099 20 34 View alignment SCOP MMDB CATH Chain C = 0.002099 20 34 View alignment Chain A = 0.002099 20 34 View alignment Chain D = 0.002099 20 34 View alignment 2pm9 ( Chain: A) Crystal structure of yeast sec13/31 vertex element of the copii vesicular coat PDB_Info PDB_Structure Saccharomyces cerevisiae 0.002400 22 35 View alignment SCOP MMDB CATH 1b9x ( Chain: A) Structural analysis of phosducin and its phosphorylation- regulated interaction with transducin PDB_Info PDB_Structure Bos taurus | Rattus norvegicus 0.009504 28 25 View alignment SCOP MMDB CATH 1omw ( Chain: B) Crystal structure of the complex between g protein-coupled receptor kinase 2 and heterotrimeric g protein beta 1 and gamma 2 subunits PDB_Info PDB_Structure Bos taurus 0.009504 28 25 View alignment SCOP MMDB CATH 2trc ( Chain: B) Phosducin/transducin beta-gamma complex PDB_Info PDB_Structure Bos taurus | Rattus norvegicus 0.009504 28 25 View alignment SCOP MMDB CATH 1gp2 ( Chain: B) G protein heterotrimer gi_alpha_1 beta_1 gamma_2 with gdp bound PDB_Info PDB_Structure Rattus norvegicus | Bos taurus 0.009504 28 25 View alignment SCOP MMDB CATH 1b9y ( Chain: A) Structural analysis of phosducin and its phosphorylation- regulated interaction with transducin beta-gamma PDB_Info PDB_Structure Bos taurus | Rattus norvegicus 0.009504 28 25 View alignment SCOP MMDB CATH 1tbg ( Chain: B, A, C, D) Beta-gamma dimer of the heterotrimeric g-protein transducin PDB_Info PDB_Structure Bos taurus Chain B = 0.009504 28 25 View alignment SCOP MMDB CATH Chain A = 0.009504 28 25 View alignment Chain C = 0.009504 28 25 View alignment Chain D = 0.009504 28 25 View alignment 2qns ( Chain: A) Crystal structure of the g-protein betagamma subunit bound to a c-terminal region of the pth1 parathyroid hormone receptor PDB_Info PDB_Structure Homo sapiens 0.009504 28 25 View alignment SCOP MMDB CATH 1a0r ( Chain: B) Heterotrimeric complex of phosducin/transducin beta-gamma PDB_Info PDB_Structure Bos taurus 0.009504 28 25 View alignment SCOP MMDB CATH 2bcj ( Chain: B) Crystal structure of g protein-coupled receptor kinase 2 in complex with galpha-q and gbetagamma subunits PDB_Info PDB_Structure Bos taurus 0.009504 28 25 View alignment SCOP MMDB CATH 1gg2 ( Chain: B) G protein heterotrimer mutant gi_alpha_1(g203a) beta_1 gamma_2 with gdp bound PDB_Info PDB_Structure Rattus norvegicus | Bos taurus 0.009504 28 25 View alignment SCOP MMDB CATH 3cik ( Chain: B) Human grk2 in complex with gbetagamma subunits PDB_Info PDB_Structure Homo sapiens | Bos taurus 0.009504 28 25 View alignment SCOP MMDB CATH 1got ( Chain: B) Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits PDB_Info PDB_Structure Bos taurus 0.009504 28 25 View alignment SCOP MMDB CATH 1xhm ( Chain: A) The crystal structure of a biologically active peptide (sigk) bound to a g protein beta:gamma heterodimer PDB_Info PDB_Structure Bos taurus 0.009504 28 25 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
GLE2	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YER107C	SGD Systematic Sequence
856844	NCBI: Gene ID
NP_011033.1	NCBI: RefSeq protein version ID
NP_011033.1	NCBI: RefSeq protein version ID
6320954	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
46 curated references; 0 references not yet curated
Function/Process Mutants/Phenotypes Strains/Constructs	Ahmed S, et al. (2010) DNA zip codes control an ancient mechanism for gene targeting to the nuclear periphery. Nat Cell Biol 12(2):111-8	|INO1 |MLP2 |NUP1 |NUP157 |NUP2 |NUP60 |SAC3 |SUS1 |THP1 |TSA2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Dawson TR, et al. (2009) ER membrane-bending proteins are necessary for de novo nuclear pore formation. J Cell Biol 184(5):659-75	|NEM1 |NIC96 |NUP116 |NUP120 |NUP133 |NUP145 |NUP188 |NUP49 |NUP82 |NUP84 |NUP85 |POM152 |POM34 |RTN1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hung NJ, et al. (2008) Arx1 Is a Nuclear Export Receptor for the 60S Ribosomal Subunit in Yeast. Mol Biol Cell 19(2):735-44	|ARX1 |CRM1 |MEX67 |MTR2 |NIC96 |NMD3 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP42 |NUP57 |NUP82 |MORE
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |NMD3 |MORE
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP157 |NUP159 |NUP170 |NUP192 |NUP2 |MORE
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MAD1 |MORE
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Thakurta AG, et al. (2007) The Nuclear Export Signal of Splicing Factor Uap56p Interacts with Nuclear Pore-associated Protein Rae1p for mRNA Export in Schizosaccharomyces pombe. J Biol Chem 282(24):17507-16	|SUB2 |YRA1
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miao M, et al. (2006) The integral membrane protein pom34p functionally links nucleoporin subcomplexes. Genetics 172(3):1441-57	|ASM4 |NSP1 |NUP100 |NUP116 |NUP120 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP57 |NUP82 |POM152 |POM34 |MORE
Fungal Related Genes/Proteins Mutants/Phenotypes	Snoek IS and Steensma HY (2006) Why does Kluyveromyces lactis not grow under anaerobic conditions? Comparison of essential anaerobic genes of Saccharomyces cerevisiae with the Kluyveromyces lactis genome. FEMS Yeast Res 6(3):393-403	|ACP1 |ARB1 |ARG82 |ARH1 |ARV1 |ATM1 |BTS1 |BUR6 |CAB2 |CAX4 |CDC40 |CNM67 |CTF4 |DBP7 |MORE
Protein Physical Properties Protein-protein Interactions Strains/Constructs	Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51	|KAP123 |MEX67 |MLP1 |NIC96 |NSP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP49 |NUP57 |MORE
Fungal Related Genes/Proteins	Andoh T, et al. (2004) The fission yeast ptr1+ gene involved in nuclear mRNA export encodes a putative ubiquitin ligase. Biochem Biophys Res Commun 317(4):1138-43	|CDC7 |SMY2 |TOM1
Cellular Location Genetic Interactions Mutants/Phenotypes Regulation of Strains/Constructs	Izawa S, et al. (2004) Gle2p is essential to induce adaptation of the export of bulk poly(A)+ mRNA to heat shock in Saccharomyces cerevisiae. J Biol Chem 279(34):35469-78	|NUP42
Fungal Related Genes/Proteins Protein Sequence Features	Larsen NA and Harrison SC (2004) Crystal structure of the spindle assembly checkpoint protein Bub3. J Mol Biol 344(4):885-92	|BUB1 |BUB3 |MAD3
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miller AL, et al. (2004) Cytoplasmic inositol hexakisphosphate production is sufficient for mediating the Gle1-mRNA export pathway. J Biol Chem 279(49):51022-32	|GLE1 |IPK1 |MSS4 |NUP116 |NUP159 |NUP42
Non-Fungal Related Genes/Proteins	Sitterlin D (2004) Characterization of the Drosophila Rae1 protein as a G1 phase regulator of the cell cycle. Gene 326():107-16
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features	Thakurta AG, et al. (2004) Conserved nuclear export sequences in Schizosaccharomyces pombe Mex67 and human TAP function in mRNA export by direct nuclear pore interactions. J Biol Chem 279(17):17434-42	|MEX67 |NUP159
Non-Fungal Related Genes/Proteins	Babu JR, et al. (2003) Rae1 is an essential mitotic checkpoint regulator that cooperates with Bub3 to prevent chromosome missegregation. J Cell Biol 160(3):341-53	|BUB3
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Chekanova JA and Belostotsky DA (2003) Evidence that poly(A) binding protein has an evolutionarily conserved function in facilitating mRNA biogenesis and export. RNA 9(12):1476-90	|NAB2 |PAB1 |RNA15
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Cellular Location Function/Process Strains/Constructs	Strawn LA, et al. (2001) The GLFG regions of Nup116p and Nup100p serve as binding sites for both Kap95p and Mex67p at the nuclear pore complex. J Biol Chem 276(9):6445-52	|DBP5 |GLE1 |KAP95 |MEX67 |MTR2 |NUP100 |NUP116
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |MORE
Non-Fungal Related Genes/Proteins	Wang X, et al. (2001) The mitotic checkpoint protein hBUB3 and the mRNA export factor hRAE1 interact with GLE2p-binding sequence (GLEBS)-containing proteins. J Biol Chem 276(28):26559-67	|BUB3
Protein-protein Interactions	Bailer SM, et al. (2000) Nup116p associates with the Nup82p-Nsp1p-Nup159p nucleoporin complex. J Biol Chem 275(31):23540-8	|NSP1 |NUP116 |NUP159 |NUP82
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MLP1 |MORE
Alias Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89	|CRM1 |CSE1 |DBP5 |FAL1 |GLE1 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR2 |MTR4 |MORE
Alias Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Strasser K, et al. (2000) Binding of the Mex67p/Mtr2p heterodimer to FXFG, GLFG, and FG repeat nucleoporins is essential for nuclear mRNA export. J Cell Biol 150(4):695-706	|MEX67 |MTR2 |NSP1 |NUP116 |NUP159 |NUP42
Non-Fungal Related Genes/Proteins Protein Sequence Features	Yu L, et al. (2000) Thirty-plus functional families from a single motif. Protein Sci 9(12):2470-6	|CDC20 |CDC4 |CDC40 |DIP2 |DOA1 |MET30 |POP2 |PRP19 |PRP4 |SEC13 |SOF1 |TUP1
Non-Fungal Related Genes/Proteins	Pritchard CE, et al. (1999) RAE1 is a shuttling mRNA export factor that binds to a GLEBS-like NUP98 motif at the nuclear pore complex through multiple domains. J Cell Biol 145(2):237-54	|NUP116
Other Features	Seedorf M, et al. (1999) Interactions between a nuclear transporter and a subset of nuclear pore complex proteins depend on Ran GTPase. Mol Cell Biol 19(2):1547-57	|CRM1 |GSP1 |KAP95 |NSP1 |NUP1 |NUP116 |NUP145 |NUP159 |NUP82 |POM152 |PSE1 |RNA1 |SRM1 |SRP1 |MORE
Cellular Location Protein-protein Interactions	Bailer SM, et al. (1998) Nup116p and nup100p are interchangeable through a conserved motif which constitutes a docking site for the mRNA transport factor gle2p. EMBO J 17(4):1107-19	|NUP100 |NUP116
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Bucci M and Wente SR (1998) A novel fluorescence-based genetic strategy identifies mutants of Saccharomyces cerevisiae defective for nuclear pore complex assembly. Mol Biol Cell 9(9):2439-61	|NIC96 |NSP1 |NUP116 |NUP120 |NUP145 |NUP159 |NUP49 |NUP57 |NUP82 |POM152
Genetic Interactions Protein-protein Interactions	Ho AK, et al. (1998) The integral membrane protein snl1p is genetically linked to yeast nuclear pore complex function. Mol Biol Cell 9(2):355-73	|NIC96 |NUP100 |NUP116 |POM152 |SNL1
Fungal Related Genes/Proteins	Wu L, et al. (1998) A role for NIMA in the nuclear localization of cyclin B in Aspergillus nidulans. J Cell Biol 141(7):1575-87
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Bharathi A, et al. (1997) The human RAE1 gene is a functional homologue of Schizosaccharomyces pombe rae1 gene involved in nuclear export of Poly(A)+ RNA. Gene 198(1-2):251-8
Function/Process Mutants/Phenotypes Other Features Techniques and Reagents	Bucci M and Wente SR (1997) In vivo dynamics of nuclear pore complexes in yeast. J Cell Biol 136(6):1185-99	|NUP49
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MTR4 |MORE
Protein-protein Interactions	Iovine MK and Wente SR (1997) A nuclear export signal in Kap95p is required for both recycling the import factor and interaction with the nucleoporin GLFG repeat regions of Nup116p and Nup100p. J Cell Biol 137(4):797-811	|GSP1 |KAP95 |NUP1 |NUP100 |NUP116 |SRP1
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Kraemer D and Blobel G (1997) mRNA binding protein mrnp 41 localizes to both nucleus and cytoplasm. Proc Natl Acad Sci U S A 94(17):9119-24
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Fungal Related Genes/Proteins	Yoon JH, et al. (1997) Npp106p, a Schizosaccharomyces pombe nucleoporin similar to Saccharomyces cerevisiae Nic96p, functionally interacts with Rae1p in mRNA export. Mol Cell Biol 17(12):7047-60	|NIC96
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Murphy R, et al. (1996) GLE2, a Saccharomyces cerevisiae homologue of the Schizosaccharomyces pombe export factor RAE1, is required for nuclear pore complex structure and function. Mol Biol Cell 7(12):1921-37	|NUP100 |NUP145 |NUP42 |SRP1
Alias Mutants/Phenotypes	Smith V, et al. (1996) Functional analysis of the genes of yeast chromosome V by genetic footprinting. Science 274(5295):2069-74	|CHD1 |COX15 |FLO8 |GIM4 |GLY1 |LCP5 |MET6 |MMS21 |MOT2 |PRB1 |PRE1 |RAD51 |RTR1 |TRP2 |MORE

Return to SGD

Send a Message to the SGD Curators