NUP157/YER105C Single Page Format

Help

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

SGD Locus Page

Names and Identifiers [TOP] [NEXT] Help
Standard Name Systematic Name Alias Feature Type SGDID
NUP157 YER105C   ORF, Verified S000000907
Description
Abundant subunit of the nuclear pore complex (NPC), present on both sides of the NPC; has similarity to Nup170p; essential role, with Nup170p, in NPC assembly

GO Annotations [TOP] [NEXT] Help
Molecular Function
Annotation(s)Reference(s)EvidenceAssigned By
structural constituent of nuclear poreDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR004870
Assigned on 2007-05-23
UniProtKB
structural molecule activityFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-18
SGD
Biological Process
Annotation(s)Reference(s)EvidenceAssigned By
NLS-bearing substrate import into nucleusFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-18
SGD
establishment of protein localizationHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
mRNA export from nucleusFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
IMP : Inferred from Mutant Phenotype
Assigned on 2001-01-18
SGD
mRNA transportGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0509
Assigned on 2007-05-23
UniProtKB
mRNA-binding (hnRNP) protein import into nucleusFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-18
SGD
nuclear pore complex assemblyMakio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IGI : Inferred from Genetic Interaction with SGD:NUP170
Assigned on 2009-05-11
SGD
nuclear pore organizationFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-18
SGD
nucleocytoplasmic transportDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR004870
Assigned on 2007-05-23
UniProtKB
protein export from nucleusFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-18
SGD
protein transportGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23
UniProtKB
rRNA export from nucleusFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-18
SGD
ribosomal protein import into nucleusFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-18
SGD
snRNA export from nucleusFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-18
SGD
snRNP protein import into nucleusFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-18
SGD
tRNA export from nucleusFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-18
SGD
transmembrane transportGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0811
Assigned on 2009-10-01
UniProtKB
transportGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23
UniProtKB
Cellular Component
Annotation(s)Reference(s)EvidenceAssigned By
membraneGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2008-06-16
UniProtKB
nuclear poreFabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
IDA : Inferred from Direct Assay
Assigned on 2001-01-18
SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR004870
Assigned on 2007-05-23
UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0906
Assigned on 2007-05-23
UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:SL-0185
Assigned on 2009-05-06
UniProtKB
nucleusGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0539
Assigned on 2009-06-29
UniProtKB

Pathways [TOP] [NEXT] Help
No pathways available

Summary Paragraph [TOP] [NEXT] Help
SUMMARY PARAGRAPH for NUP157/YER105C for NUP157
NUP157 encodes a nuclear pore protein (1, 2). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 2, 3, 4, 5). The structure of the vertebrate NPC has been studied extensively; recent reviews include 6, 7, 8, and 9. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (10, 11). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 2, 3, 12, 13, 14). Nup157p is one of the most abundant yeast nucleoporins (1). Nup157p interacts physically with other abundant yeast nucleoporins, Nic96p, Pom152p, Nup170p, and Nup188p (2). These abundant nucleoporins may form the structural core of the NPC (2). NUP157 is not essential, but nup157 mutations are synthetically lethal with mutations in several other nucleoporin genes (1, 15, 2).

Last Updated: 1999-08-11

Basic References [TOP]   Help
BASIC INFORMATION REFERENCES forNUP157/YER105C for NUP157
1)Aitchison JD, et al. (1995) Two novel related yeast nucleoporins Nup170p and Nup157p: complementation with the vertebrate homologue Nup155p and functional interactions with the yeast nuclear pore-membrane protein Pom152p. J Cell Biol 131(5):1133-48
SGD Papers Entry  Pubmed Entry  
2)Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
SGD Papers Entry  Pubmed Entry  
3)Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
SGD Papers Entry  
4)Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9
SGD Papers Entry  Pubmed Entry  
5)Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64
SGD Papers Entry  Pubmed Entry  
6)Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20
SGD Papers Entry  Pubmed Entry  
7)Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99
SGD Papers Entry  Pubmed Entry  
8)Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96
SGD Papers Entry  Pubmed Entry  
9)Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89
SGD Papers Entry  Pubmed Entry  
10)Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83
SGD Papers Entry  Pubmed Entry  
11)Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
12)Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11
SGD Papers Entry  Pubmed Entry  
13)Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
14)Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407
SGD Papers Entry  Pubmed Entry  
15)Nehrbass U, et al. (1996) The yeast nucleoporin Nup188p interacts genetically and physically with the core structures of the nuclear pore complex. J Cell Biol 133(6):1153-62
SGD Papers Entry  Pubmed Entry  
16)Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
17)Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

Mutant Phenotypes [TOP] [NEXT] Help
Phenotype page for NUP157/YER105C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT] Help
Interaction page for NUP157/YER105C

Homologs [TOP] [NEXT] Help
  • Comparison Resources
  • Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT] Help
    Protein Sequence Calculations
    from Predicted Full length Translation
    N-term MYSTPLK
    C-term DRHHGLK
    Length(aa) 1,391
    MW(Da) 156,647
    pI 6.4
    Amino Acid Composition (full length)
    GCG tools: PepPlot, Helical Wheel, PepStruct

    Transcript Translation Calculations
    Codon Bias 0.026  
    Codon Adaptation Index 0.133  
    Frequency of Optimal Codons 0.425  
    Hydropathicity of Protein -0.206  
    Aromaticity Score 0.097  

                              10        20        30        40        50
                               |         |         |         |         |
                      MYSTPLKKRIDYDRETFTASASLGGNRLRNRPRDDQNNGKPNLSSRSFLS
                      ERKTRKDVLNKYGEAGNTIESELRDVTTHVKISGLTSSEPLQLASEFVQD
                      LSFRDRNTPILDNPDYYSKGLDYNFSDEVGGLGAFTPFQRQQVTNIPDEV
                      LSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINNSSEYHCIDEIEHT
                      ILKVKLVKPSPNTFVSSVENLLIVATLFDIYILTISFNDRTHELNIFNTG
                      LKVNVTGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSKSN
                      KICLTKSNLANLLPTKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQS
                      RGVLHTLSTKSIVRSYLITSNGLVGPVLIDAAHIRRGMNALGVKNSPLLS
                      NRAFKIAKIVSISMCENNDLFLAVITTTGVRLYFKGSISRRSIGSLKLDS
                      VKFPPTSISSSLEQNKSFIIGHHPLNTHDTGPLSTQKASSTYINTTCAST
                      IISPGIYFTCVRKRANSGELSKGITNKALLENKEEHKLYVSAPDYGILKN
                      YGKYVENTALLDTTDEIKEIVPLTRSFNYTSTPQGYANVFASQYSAEPLK
                      VAVLTSNALEIYCYRTPDEVFESLIENPLPFIHSYGLSEACSTALYLACK
                      FNKSEHIKSSALAFFSAGIPGVVEIKPKSSRESGSVPPISQNLFDKSGEC
                      DGIVLSPRFYGSALLITRLFSQIWEERVFVFKRASKTEKMDAFGISITRP
                      QVEYYLSSISVLADFFNIHRPSFVSFVPPKGSNAITASDAESIAMNALIL
                      LINSIKDALSLINVFYEDIDAFKSLLNTLMGAGGVYDSKTREYFFDLKFH
                      DLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERFGSFCHSAD
                      ILCYRAGEHLEAAQKFEMIDSKISRNHLDTAIDLYERCAENIELCELRRV
                      VDIMVKLNYQPKTVGFLLRFADKIDKGNQAQEYVSRGCNTADPRKVFYDK
                      RINVYTLIFEIVKSVDDYTSIEQSPSIANISIFSPASSLKKRVYSVIMNS
                      NNRFFHYCFYDWLVANKRQDYLLRLDSQFVLPYLKERAEKSLEISNLLWF
                      YLFKEEHFLEAADVLYALASSDFDLKLSERIECLARANGLCDSSTSFDQK
                      PALVQLSENIHELFDIASIQDDLLNLVRNETRIDEDYRKQLTLKLNGRVL
                      PLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQGEWNRLLDSMKNAPS
                      PDVGSVGQESFLSSISNTLIRIGKTTRDTDVVFPVHFLMNKILESFIDKS
                      SAADGSVCSMFLLAGVSHLKLYYILSRIIENSEGNVELAKKEMVWLIKDW
                      YQSDSDLRGSIAPEQIKKLEKYDPNTDPVQDYVKDRHHGLK*
    

    Protein Structures from PDB: proteins of known structure with sequence similarity to NUP157/YER105C, based on Smith-Waterman analysis. [TOP] [NEXT] Help
    PDB protein structure(s) homologous to NUP157Homolog Source (per PDB)Protein Alignment: NUP157 vs. HomologExternal Links
    P-Value%Identical%SimilarAlignment
    3i5p ( Chain: A)
    Nucleoporin NUP170
  • PDB_Info
  • PDB_Structure
  • Unknown4.1e-894034View alignmentSCOP
    MMDB
    CATH
    3i5q ( Chain: A, B)
    Nucleoporin NUP170
  • PDB_Info
  • PDB_Structure
  • UnknownChain A = 3.5e-353836View alignmentSCOP
    MMDB
    CATH
    Chain B = 3.5e-353836View alignment

    Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT] Help
  • Functional Analysis
  • You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

    Locus History (misc. notes) [TOP] [NEXT] Help
    Nomenclature History
    Standard NameReference
    NUP157SGD (2007) Information without a citation in SGD
    SGD Papers Entry  

    Sequence Retrieval [TOP] [NEXT] Help
    Sequence Type Output Format
    Genomic DNA GCG | FASTA | NoHeader
    Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader
    DNA coding sequence
    (without introns, without flanking regions)
    GCG | FASTA | NoHeader
    Protein Translation of ORF GCG | FASTA | NoHeader
    6-Frame Translation(with Restriction Map) GCG
    Restriction Fragment Sizes GCG
  • Sequence Analysis Tools
  • Sequence from other databases
    Sequence IDSource
    YER105CSGD Systematic Sequence
    856842NCBI: Gene ID
    NP_011031.1NCBI: RefSeq protein version ID
    NP_011031.1NCBI: RefSeq protein version ID
    6320952NCBI: NCBI protein GI

    Map and Displays [TOP] [NEXT] Help
    Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
    Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map  

    Localization [TOP] [NEXT] Help
  • Localization Resources
  • Community Annotation [TOP] [NEXT] Help
    No community annotation available.

    Literature Guide: papers categorized by topic. [TOP]   Help
    TopicsReferenceOther Genes Addressed
    32 curated references; 0 references not yet curated
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Ahmed S, et al. (2010) DNA zip codes control an ancient mechanism for gene targeting to the nuclear periphery. Nat Cell Biol 12(2):111-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |GLE2 |INO1 |MLP2 |NUP1 |NUP2 |NUP60 |SAC3 |SUS1 |THP1 |TSA2
    Evolution
    Non-Fungal Related Genes/Proteins
    DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |MLP1 |MLP2 |NIC96 |NUP120 |NUP133 |NUP145 |NUP159 |NUP170 |NUP188 |NUP192 |NUP2 |NUP82 |NUP84 |NUP85
    Genetic Interactions
    Strains/Constructs
    Flemming D, et al. (2009) Two structurally distinct domains of the nucleoporin Nup170 cooperate to tether a subset of nucleoporins to nuclear pores. J Cell Biol 185(3):387-95
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |NUP1 |NUP159 |NUP170 |NUP188 |NUP2 |NUP82 |POM152 |POM34
    Other Features
    Protein/Nucleic Acid Structure
    Lezon TR, et al. (2009) Global motions of the nuclear pore complex: insights from elastic network models. PLoS Comput Biol 5(9):e1000496
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |NUP120 |NUP145 |NUP170 |NUP192 |NUP84 |NUP85 |SEC13 |SEH1
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Regulatory Role
    Strains/Constructs
    Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP100 |NUP133 |NUP159 |NUP170 |MORE
    Protein-protein Interactions
    Onischenko E, et al. (2009) Role of the Ndc1 interaction network in yeast nuclear pore complex assembly and maintenance. J Cell Biol 185(3):475-91
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ASM4 |MPS3 |NDC1 |NPL3 |NUP133 |NUP170 |NUP188 |NUP2 |NUP53 |NUP82 |POM152 |POM34
    Reviews
    Rexach M (2009) Piecing together nuclear pore complex assembly during interphase. J Cell Biol 185(3):377-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ASM4 |NDC1 |NIC96 |NUP170 |NUP188 |NUP53 |NUP82 |NUP84 |POM152 |POM34 |RTN1 |YOP1
    Cellular Location
    Computational analysis
    Protein Physical Properties
    Protein-protein Interactions
    Protein/Nucleic Acid Structure
    Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  
    |ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP159 |NUP170 |MORE
    Cellular Location
    Evolution
    Protein/Nucleic Acid Structure
    Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  
    |ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP159 |NUP170 |MORE
    Protein-protein Interactions
    Techniques and Reagents
    Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
    Cellular Location
    Function/Process
    Protein Sequence Features
    Protein-protein Interactions
    Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP159 |NUP170 |NUP192 |NUP2 |MORE
    Reviews
    Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
    Evolution
    Fungal Related Genes/Proteins
    De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81
    SGD Papers Entry  Pubmed Entry  Reference full text  
    |AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
    Computational analysis
    Non-Fungal Related Genes/Proteins
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP159 |NUP170 |NUP188 |NUP192 |MORE
    Protein Physical Properties
    Protein-protein Interactions
    Protein/Nucleic Acid Structure
    Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |GLE2 |KAP123 |MEX67 |MLP1 |NIC96 |NSP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP159 |NUP170 |NUP49 |NUP57 |MORE
    Protein-protein Interactions
    Palancade B, et al. (2005) Pml39, a novel protein of the nuclear periphery required for nuclear retention of improper messenger ribonucleoparticles. Mol Biol Cell 16(11):5258-68
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |MLP1 |MLP2 |NAB2 |NUP120 |NUP133 |NUP60 |PML1 |PML39 |RRP6 |YRA1
    Mutants/Phenotypes
    Strains/Constructs
    Aye M, et al. (2004) Host factors that affect Ty3 retrotransposition in Saccharomyces cerevisiae. Genetics 168(3):1159-76
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AIM5 |AMS1 |BRO1 |CDC39 |CDH1 |CKA1 |CRG1 |CYR1 |DAP1 |DML1 |ECM30 |FLC2 |FLO5 |FRE3 |MORE
    Protein Physical Properties
    Protein Sequence Features
    Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP159 |MORE
    Cellular Location
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Protein-protein Interactions
    Strains/Constructs
    Iouk T, et al. (2002) The yeast nuclear pore complex functionally interacts with components of the spindle assembly checkpoint. J Cell Biol 159(5):807-19
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ASM4 |MAD1 |MAD2 |NUP100 |NUP170 |NUP188 |NUP53 |POM152
    Function/Process
    Fungal Related Genes/Proteins
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Kerscher O, et al. (2001) Novel role for a Saccharomyces cerevisiae nucleoporin, Nup170p, in chromosome segregation. Genetics 157(4):1543-53
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CBF2 |CTF13 |NUP170
    Reviews
    Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
    Cellular Location
    Protein Physical Properties
    Strains/Constructs
    Techniques and Reagents
    Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CRM1 |CSE1 |DBP5 |FAL1 |GLE1 |GLE2 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR2 |MORE
    Non-Fungal Related Genes/Proteins
    Gigliotti S, et al. (1998) Nup154, a new Drosophila gene essential for male and female gametogenesis is related to the nup155 vertebrate nucleoporin gene. J Cell Biol 142(5):1195-207
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |NUP170
    Non-Fungal Related Genes/Proteins
    Techniques and Reagents
    Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |GLE1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
    Reviews
    Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313
    SGD Papers Entry  Pubmed Entry  
    |ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
    Reviews
    Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
    SGD Papers Entry  
    |GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |MORE
    Cell Cycle Phase Involved
    Cellular Location
    Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |NUP49 |MORE
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Kenna MA, et al. (1996) Yeast N1e3p/Nup170p is required for normal stoichiometry of FG nucleoporins within the nuclear pore complex. Mol Cell Biol 16(5):2025-36
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |NUP1 |NUP170 |NUP2 |NUP82 |RNA1 |SRP1 |YRB1
    Reviews
    Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99
    SGD Papers Entry  Pubmed Entry  
    |ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
    Cellular Location
    Function/Process
    Fungal Related Genes/Proteins
    Genetic Interactions
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Aitchison JD, et al. (1995) Two novel related yeast nucleoporins Nup170p and Nup157p: complementation with the vertebrate homologue Nup155p and functional interactions with the yeast nuclear pore-membrane protein Pom152p. J Cell Biol 131(5):1133-48
    SGD Papers Entry  Pubmed Entry  
    |NIC96 |NUP170 |NUP188 |POM152
    Reviews
    Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96
    SGD Papers Entry  Pubmed Entry  
    |ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34


    Return to SGD
    Send a Message to the SGD Curators

    SGDtm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.