---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

FCY2/YER056C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrV: 268112 to 266511 CDS: 268112 - 266511 Genetic position: 49 cM Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
FCY2	YER056C	BRA7	ORF, Verified	S000000858
Description
Purine-cytosine permease, mediates purine (adenine, guanine, and hypoxanthine) and cytosine accumulation

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By cytidine transmembrane transporter activity Kurtz JE, et al. (1999) New insights into the pyrimidine salvage pathway of Saccharomyces cerevisiae: requirement of six genes for cytidine metabolism. Curr Genet 36(3):130-6        IMP : Inferred from Mutant Phenotype IDA : Inferred from Direct Assay Assigned on 2005-11-15 SGD nucleobase transmembrane transporter activity Ferreira T, et al. (1997) Functional analysis of mutated purine-cytosine permease from Saccharomyces cerevisiae. A possible role of the hydrophilic segment 371-377 in the active carrier conformation. J Biol Chem 272(15):9697-702        IDA : Inferred from Direct Assay Assigned on 2002-09-19 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001248 , EBI:IPR012681 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By cytidine transport Kurtz JE, et al. (1999) New insights into the pyrimidine salvage pathway of Saccharomyces cerevisiae: requirement of six genes for cytidine metabolism. Curr Genet 36(3):130-6        IMP : Inferred from Mutant Phenotype IDA : Inferred from Direct Assay Assigned on 2005-11-15 SGD cytosine transport Ferreira T, et al. (1997) Functional analysis of mutated purine-cytosine permease from Saccharomyces cerevisiae. A possible role of the hydrophilic segment 371-377 in the active carrier conformation. J Biol Chem 272(15):9697-702        IDA : Inferred from Direct Assay Assigned on 2002-09-19 SGD endoplasmic reticulum organization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT nucleobase, nucleoside, nucleotide and nucleic acid transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001248 , EBI:IPR012681 Assigned on 2007-05-23 UniProtKB purine transport Ferreira T, et al. (1997) Functional analysis of mutated purine-cytosine permease from Saccharomyces cerevisiae. A possible role of the hydrophilic segment 371-377 in the active carrier conformation. J Biol Chem 272(15):9697-702        IDA : Inferred from Direct Assay Assigned on 2002-09-19 SGD regulation of transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transmembrane transport Ferreira T, et al. (1997) Functional analysis of mutated purine-cytosine permease from Saccharomyces cerevisiae. A possible role of the hydrophilic segment 371-377 in the active carrier conformation. J Biol Chem 272(15):9697-702        IDA : Inferred from Direct Assay Assigned on 2009-04-16 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR012681 , EBI:IPR001248 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001248 , EBI:IPR012681 Assigned on 2009-06-17 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB plasma membrane Grandier-Vazeille X, et al. (1993) Detection of purine cytosine permease of S. cerevisiae: use of antibodies against a synthetic peptide corresponding to a predicted sequence in the N-terminal domain of the protein. Biochem Biophys Res Commun 197(2):372-9      IDA : Inferred from Direct Assay Assigned on 2002-09-19 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for FCY2/YER056C for FCY2 Fcy2p is a purine-cytosine permease that mediates the active transport of adenine, hypoxanthine, guanine and cytosine through the plasma membrane and into the cell (1, 2, 3, 4, 5). Fcy2p also shows a low affinity for cytidine, and mediates its transport into the cell, but is unable to transport uracil or ATP (1, 6, 7). The amino acids at positions 374 and 377 modulate the affinity of Fcy2p towards its substrates (8). Fcy2p may be required for adenine repression of ADE genes (9), and its localization to the plasma membrane requires a functional secretory pathway and is reduced in mnn9 mutants (10, 3). Lithium chloride represses the transcription of FCY2 during growth on galactose (11), and Fcy2p activity is inhibited by 2,4-dinitrophenyl, sodium azide, chlorohexidine and 8-azidoadenine (12, 13). Fcy2p is phosphorylated in vivo either between the Golgi apparatus and the plasma membrane or in the plasma membrane itself (14), but the functional significance of this phosphorylation has not yet been determined (12). Fcy2p has also been reported to be glycosylated in vivo (7), but it was later shown that N-linked glycosylation is not required for the permease activity, and may not actually occur (15). fcy2 null mutants are viable, but do not display normal repression of ADE5,7 and ADE1 in the presence of adenine, or of IMD2 in the presence of guanine. In addition, they are unable to take up guanine, adenine, hypoxanthine, 5-methylcytosine, or cytosine (16, 17, 3, 18). Further, fcy2 mutants are resistant to 8-azaadenine, 8-azaguanine, 5-fluorocytosine, 5-fluorouracil and the anti-cancer drug Cisplatin, and show weak resistance to the anti-cancer drug doxorubicin (16, 9, 17). Although FCY2 is similar to FCY21 and FCY22, it does not appear that Fcy21p or Fcy22p are able to complement fcy2 mutants (19, 4). The hypoxanthine uptake defects of an fcy2 null mutant are functionally complemented by human ENT2, which is an equilibrative (Na+-independent) nucleoside transporter belonging to a family of integral membrane proteins with 11 transmembrane domains (TMs) that are distinguished functionally by differences in sensitivity to inhibition by nitrobenzylthioinosine and coronary vasoactive drugs. This family also includes human ENT1, and rat rENT1 and rENT2 (18). Last Updated: 2005-11-15

Basic References [TOP]

BASIC INFORMATION REFERENCES forFCY2/YER056C for FCY2 1) Kurtz JE, et al. (1999) New insights into the pyrimidine salvage pathway of Saccharomyces cerevisiae: requirement of six genes for cytidine metabolism. Curr Genet 36(3):130-6        2) Ferreira T, et al. (1999) Screening of an intragenic second-site suppressor of purine-cytosine permease from Saccharomyces cerevisiae. Possible role of Ser272 in the base translocation process. Eur J Biochem 260(1):22-30        3) Ferreira T, et al. (1997) Functional analysis of mutated purine-cytosine permease from Saccharomyces cerevisiae. A possible role of the hydrophilic segment 371-377 in the active carrier conformation. J Biol Chem 272(15):9697-702        4) Wagner R, et al. (2001) New plasmid system to select for Saccharomyces cerevisiae purine-cytosine permease affinity mutants. J Bacteriol 183(14):4386-8        5) Hopkins P, et al. (1992) Fluorocytosine causes uncoupled dissipation of the proton gradient and behaves as an imperfect substrate of the yeast cytosine permease. Yeast 8(12):1053-64      6) Mitterbauer R, et al. (2002) Saccharomyces cerevisiae URH1 (encoding uridine-cytidine N-ribohydrolase): functional complementation by a nucleoside hydrolase from a protozoan parasite and by a mammalian uridine phosphorylase. Appl Environ Microbiol 68(3):1336-43        7) Schmidt R, et al. (1984) Photoaffinity labeling and characterization of the cloned purine-cytosine transport system in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 81(20):6276-80      8) Bloch JC, et al. (1992) Determination of a specific region of the purine-cytosine permease involved in the recognition of its substrates. Mol Microbiol 6(20):2989-97      9) Guetsova ML, et al. (1997) The isolation and characterization of Saccharomyces cerevisiae mutants that constitutively express purine biosynthetic genes. Genetics 147(2):383-97      10) Weber E, et al. (1990) The purine-cytosine permease gene of Saccharomyces cerevisiae: primary structure and deduced protein sequence of the FCY2 gene product. Mol Microbiol 4(4):585-96      11) Mitterbauer R, et al. (2003) A sensitive and inexpensive yeast bioassay for the mycotoxin zearalenone and other compounds with estrogenic activity. Appl Environ Microbiol 69(2):805-11        12) Vickers MF, et al. (2001) Functional production of mammalian concentrative nucleoside transporters in Saccharomyces cerevisiae. Mol Membr Biol 18(1):73-9        13) Chirio MC, et al. (1990) Photoaffinity labelling of the purine-cytosine permease of Saccharomyces cerevisiae. Eur J Biochem 194(1):293-9      14) Pinson B, et al. (1996) In vivo phosphorylation of the purine/cytosine permease from the plasma membrane of the yeast Saccharomyces cerevisiae. Eur J Biochem 239(2):439-44      15) Rodriguez C, et al. (1995) The immunodetected yeast purine-cytosine permease is not N-linked glycosylated, nor are glycosylation sequences required to have a functional permease. Yeast 11(1):15-23      16) Huang RY, et al. (2005) Genome-wide screen identifies genes whose inactivation confer resistance to cisplatin in Saccharomyces cerevisiae. Cancer Res 65(13):5890-7          17) Escobar-Henriques M and Daignan-Fornier B (2001) Transcriptional regulation of the yeast gmp synthesis pathway by its end products. J Biol Chem 276(2):1523-30        18) Yao SY, et al. (2002) Functional and molecular characterization of nucleobase transport by recombinant human and rat equilibrative nucleoside transporters 1 and 2. Chimeric constructs reveal a role for the ENT2 helix 5-6 region in nucleobase translocation. J Biol Chem 277(28):24938-48        19) Nelissen B, et al. (1995) Phylogenetic classification of the major superfamily of membrane transport facilitators, as deduced from yeast genome sequencing. FEBS Lett 377(2):232-6        20) Weber, E. (1989) Personal Communication, Mortimer Map Edition 10

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for FCY2/YER056C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for FCY2/YER056C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MLEEGNN C-term ELKYFGR Length(aa) 533 MW(Da) 58,201 pI 4.96 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.238   Codon Adaptation Index 0.202   Frequency of Optimal Codons 0.544   Hydropathicity of Protein 0.487   Aromaticity Score 0.148

10 20 30 40 50 | | | | | MLEEGNNVYEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVE SSEATKLSWFHKFFASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMV IASYALGALGPMVFGLNFGQSVLVIIFFNIMGLIFVAFFSVFGAELGLRQ MILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLLNMVNEGSGHVC PIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSRSG KFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYK IFFSLVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAIL VPNSLNGFGQFCCVLLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVW TMAGNAATLGISIPATYYFDGFMENFMDSIGYYLAIYIAISCSEHFFYRR SFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGRLI GKYGGDIGFELGASWAFIIYNILRPLELKYFGR*

Protein Structures from PDB: proteins of known structure with sequence similarity to FCY2/YER056C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
FCY2	Weber, E. (1989) Personal Communication, Mortimer Map Edition 10

Alias Name(s)	Reference
BRA7	Guetsova ML, et al. (1997) The isolation and characterization of Saccharomyces cerevisiae mutants that constitutively express purine biosynthetic genes. Genetics 147(2):383-97

Mapping Notes

Date	Note
1989-10-01	Edition 10: fcy2 is < 1cM distal to his1 Mortimer RK, et al. (1989) Genetic map of Saccharomyces cerevisiae, edition 10. Yeast 5(5):321-403

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YER056C	SGD Systematic Sequence
856783	NCBI: Gene ID
NP_010976.1	NCBI: RefSeq protein version ID
NP_010976.1	NCBI: RefSeq protein version ID
6320897	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
39 curated references; 0 references not yet curated
Evolution Fungal Related Genes/Proteins	Hamari Z, et al. (2009) Convergent evolution and orphan genes in the Fur4p-like family and characterization of a general nucleoside transporter in Aspergillus nidulans. Mol Microbiol 73(1):43-57	|DAL4 |FCY21 |FCY22 |FUI1 |FUN26 |FUR4 |NRT1 |THI7 |THI72 |TPN1
Cross-species Expression Strains/Constructs	Mansfield TA, et al. (2009) AtAzg1 and AtAzg2 comprise a novel family of purine transporters in Arabidopsis. FEBS Lett 583(2):481-6
Regulation of	Zhang Z, et al. (2009) Positive selection for elevated gene expression noise in yeast. Mol Syst Biol 5:299	|AGP1 |AQR1 |DIP5 |FET4 |FTR1 |FUI1 |HXT2 |HXT3 |MUP1 |OPT1 |QDR2 |SAM3 |THI7 |TPO1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kowalski D, et al. (2008) Dysregulation of Purine Nucleotide Biosynthesis Pathways Modulates Cisplatin Cytotoxicity in Saccharomyces cerevisiae. Mol Pharmacol 74(4):1092-100	|AAH1 |ADE1 |ADE13 |ADE16 |ADE17 |ADE4 |APT1 |BAS1 |GUK1 |HPT1 |PHO2 |RAD52
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Paluszynski JP, et al. (2008) Genetic prerequisites for additive or synergistic actions of 5-fluorocytosine and fluconazole in baker's yeast. Microbiology 154(Pt 10):3154-64	|ERG11 |ERG3 |FCY1 |FUR1 |URA10 |URA5
Fungal Related Genes/Proteins	Vlanti A and Diallinas G (2008) The Aspergillus nidulans FcyB cytosine-purine scavenger is highly expressed during germination and in reproductive compartments and is downregulated by endocytosis. Mol Microbiol 68(4):959-77	|FCY21
Fungal Related Genes/Proteins Reviews	Pantazopoulou A and Diallinas G (2007) Fungal nucleobase transporters. FEMS Microbiol Rev 31(6):657-75	|FUR4
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Regulation of Transcription	Fry RC, et al. (2006) The DNA-damage signature in Saccharomyces cerevisiae is associated with single-strand breaks in DNA. BMC Genomics 7():313	|AAH1 |AHP1 |ALG14 |AMN1 |ASF1 |BAT1 |BUD4 |CAC2 |CAR1 |CDC42 |CDC8 |CHA1 |CHS2 |CIC1 |MORE
Genomic expression study	Kresnowati MT, et al. (2006) When transcriptome meets metabolome: fast cellular responses of yeast to sudden relief of glucose limitation. Mol Syst Biol 2():49	|AAH1 |ABF1 |ACO1 |ADE1 |ADE12 |ADE13 |ADE17 |ADE2 |ADE3 |ADE4 |ADE5,7 |ADE6 |ADE8 |AFT2 |MORE
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Substrates/Ligands/Cofactors	Paluszynski JP, et al. (2006) Various cytosine/adenine permease homologues are involved in the toxicity of 5-fluorocytosine in Saccharomyces cerevisiae. Yeast 23(9):707-15	|DAL4 |FCY1 |FCY21 |FCY22 |FUI1 |FUR4 |NRT1 |TPN1
Mutants/Phenotypes	Huang RY, et al. (2005) Genome-wide screen identifies genes whose inactivation confer resistance to cisplatin in Saccharomyces cerevisiae. Cancer Res 65(13):5890-7	|BUL1 |ECM30 |ELG1 |HPT1 |ITR1 |IXR1 |NMD2 |NOT3 |PAR32 |SEM1 |SKI3 |SKY1 |SNF6 |SOK1 |MORE
Cellular Location Protein Physical Properties	Kim H, et al. (2003) Topology models for 37 Saccharomyces cerevisiae membrane proteins based on C-terminal reporter fusions and predictions. J Biol Chem 278(12):10208-13	|AQY1 |ASG7 |ATO2 |AVT6 |CDC1 |ECM7 |ERP2 |ERV15 |FLD1 |HHY1 |IZH4 |MEP1 |MUP1 |OSW5 |MORE
Mutants/Phenotypes Strains/Constructs	Yao SY, et al. (2002) Functional and molecular characterization of nucleobase transport by recombinant human and rat equilibrative nucleoside transporters 1 and 2. Chimeric constructs reveal a role for the ENT2 helix 5-6 region in nucleobase translocation. J Biol Chem 277(28):24938-48
Function/Process Mutants/Phenotypes Strains/Constructs	Escobar-Henriques M and Daignan-Fornier B (2001) Transcriptional regulation of the yeast gmp synthesis pathway by its end products. J Biol Chem 276(2):1523-30	|BAS1 |GUA1 |GUK1 |HPT1 |IMD1 |IMD2 |IMD3 |IMD4 |PHO2 |YNK1
Function/Process Mutants/Phenotypes Strains/Constructs	Wagner R, et al. (2001) New plasmid system to select for Saccharomyces cerevisiae purine-cytosine permease affinity mutants. J Bacteriol 183(14):4386-8	|FCY21 |FCY22
Cellular Location Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs Substrates/Ligands/Cofactors	Ferreira T, et al. (1999) Evidence for a dynamic role for proline376 in the purine-cytosine permease of Saccharomyces cerevisiae. Eur J Biochem 263(1):57-64
Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Ferreira T, et al. (1999) Screening of an intragenic second-site suppressor of purine-cytosine permease from Saccharomyces cerevisiae. Possible role of Ser272 in the base translocation process. Eur J Biochem 260(1):22-30
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Kurtz JE, et al. (1999) New insights into the pyrimidine salvage pathway of Saccharomyces cerevisiae: requirement of six genes for cytidine metabolism. Curr Genet 36(3):130-6	|CDD1 |FCY1 |URH1 |URK1
Function/Process Protein Sequence Features	Ferreira T, et al. (1998) Role of the proline residue 376 in the catalytic activity of purine-cytosine permease of Saccharomyces cerevisiae. Folia Microbiol (Praha) 43(2):193
Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Ferreira T, et al. (1998) Role of the proline residue 376 in the catalytic activity of purine-cytosine permease ofSaccharomyces cerevisiae. Folia Microbiol (Praha) 43(2):191-3
Fungal Related Genes/Proteins	Dietrich FS, et al. (1997) The nucleotide sequence of Saccharomyces cerevisiae chromosome V. Nature 387(6632 Suppl):78-81	|ALD5 |BIM1 |FCY21 |GIP2 |HMF1 |HOR2 |MMF1 |PCL6 |PCL7 |PIG2 |RGI1 |RGI2 |RHR2 |RNR1 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein Physical Properties	Ferreira T, et al. (1997) Functional analysis of mutated purine-cytosine permease from Saccharomyces cerevisiae. A possible role of the hydrophilic segment 371-377 in the active carrier conformation. J Biol Chem 272(15):9697-702
Alias Mutants/Phenotypes Strains/Constructs	Guetsova ML, et al. (1997) The isolation and characterization of Saccharomyces cerevisiae mutants that constitutively express purine biosynthetic genes. Genetics 147(2):383-97	|AAH1 |ADE12 |ADE13 |APT1 |HPT1
Function/Process Protein Physical Properties Substrates/Ligands/Cofactors Techniques and Reagents	Pinson B, et al. (1997) Characterization of the Saccharomyces cerevisiae cytosine transporter using energizable plasma membrane vesicles. J Biol Chem 272(46):28918-24
Function/Process Mutants/Phenotypes Other Features Substrates/Ligands/Cofactors	Eddy AA and Hopkins P (1996) Cytosine accumulation as a measure of the proton electrochemical gradient acting on the overexpressed cytosine permease of Saccharomyces cerevisiae. Microbiology 142 ( Pt 3):449-57
Protein Physical Properties Protein Processing/Modification/Regulation Protein-protein Interactions Regulation of Techniques and Reagents	Pinson B, et al. (1996) In vivo phosphorylation of the purine/cytosine permease from the plasma membrane of the yeast Saccharomyces cerevisiae. Eur J Biochem 239(2):439-44
Fungal Related Genes/Proteins Reviews	Nelissen B, et al. (1995) Phylogenetic classification of the major superfamily of membrane transport facilitators, as deduced from yeast genome sequencing. FEBS Lett 377(2):232-6	|DAL4 |DUR3 |FEN2 |FUI1 |FUR4 |HOL1 |HXT11 |HXT12 |HXT17 |HXT9 |PHO84 |PTR2 |SGE1 |SNF3 |MORE
Protein Physical Properties Protein Processing/Modification/Regulation Protein-protein Interactions Techniques and Reagents	Rodriguez C, et al. (1995) The immunodetected yeast purine-cytosine permease is not N-linked glycosylated, nor are glycosylation sequences required to have a functional permease. Yeast 11(1):15-23
Protein Physical Properties Techniques and Reagents	Grandier-Vazeille X, et al. (1993) Detection of purine cytosine permease of S. cerevisiae: use of antibodies against a synthetic peptide corresponding to a predicted sequence in the N-terminal domain of the protein. Biochem Biophys Res Commun 197(2):372-9
Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Bloch JC, et al. (1992) Determination of a specific region of the purine-cytosine permease involved in the recognition of its substrates. Mol Microbiol 6(20):2989-97
Function/Process Mutants/Phenotypes Protein Physical Properties	Brethes D, et al. (1992) In vivo and in vitro studies of the purine-cytosine permease of Saccharomyces cerevisiae. Functional analysis of a mutant with an altered apparent transport constant of uptake. Eur J Biochem 204(2):699-704
Function/Process Protein Physical Properties Strains/Constructs Techniques and Reagents	Brethes D, et al. (1992) Purine-cytosine permease of Saccharomyces cerevisiae. Effect of external pH on nucleobase uptake and binding. Eur J Biochem 210(3):785-91
Function/Process Strains/Constructs Substrates/Ligands/Cofactors	Hopkins P, et al. (1992) Fluorocytosine causes uncoupled dissipation of the proton gradient and behaves as an imperfect substrate of the yeast cytosine permease. Yeast 8(12):1053-64
Protein Physical Properties	Chirio MC, et al. (1990) Photoaffinity labelling of the purine-cytosine permease of Saccharomyces cerevisiae. Eur J Biochem 194(1):293-9
DNA/RNA Sequence Features Mapping Protein Sequence Features RNA Levels and Processing Regulation of Strains/Constructs Transcription	Weber E, et al. (1990) The purine-cytosine permease gene of Saccharomyces cerevisiae: primary structure and deduced protein sequence of the FCY2 gene product. Mol Microbiol 4(4):585-96	|HIS1 |MNN9
Fungal Related Genes/Proteins Other Features	Weber E, et al. (1988) Evolutionary relationship and secondary structure predictions in four transport proteins of Saccharomyces cerevisiae. J Mol Evol 27(4):341-50	|CAN1 |FUR4 |HIP1
Function/Process Protein Physical Properties Protein Processing/Modification/Regulation Techniques and Reagents	Schmidt R, et al. (1984) Photoaffinity labeling and characterization of the cloned purine-cytosine transport system in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 81(20):6276-80
Function/Process	Reichert U, et al. (1975) A possible mechanism of energy coupling in purine transport of Saccharomyces cerevisiae. FEBS Lett 52(1):100-2

Return to SGD

Send a Message to the SGD Curators