---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

CHO1/YER026C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrV: 208473 to 207643 CDS: 208473 - 207643 Genetic position: 22 cM Genetic Map Data Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
CHO1	YER026C	PSS1	ORF, Verified	S000000828
Description
Phosphatidylserine synthase, functions in phospholipid biosynthesis; catalyzes the reaction CDP-diaclyglycerol + L-serine = CMP + L-1-phosphatidylserine, transcriptionally repressed by myo-inositol and choline

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By CDP-diacylglycerol-serine O-phosphatidyltransferase activity Atkinson KD, et al. (1980) Yeast mutants auxotrophic for choline or ethanolamine. J Bacteriol 141(2):558-64      IMP : Inferred from Mutant Phenotype Assigned on 2005-08-03 SGD Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD Bae-Lee MS and Carman GM (1984) Phosphatidylserine synthesis in Saccharomyces cerevisiae. Purification and characterization of membrane-associated phosphatidylserine synthase. J Biol Chem 259(17):10857-62      IDA : Inferred from Direct Assay Assigned on 2005-08-03 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004533 Assigned on 2007-05-23 UniProtKB GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.7.8.8 Assigned on 2007-05-23 UniProtKB phosphotransferase activity, for other substituted phosphate groups DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000462 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By CDP-diacylglycerol metabolic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004533 Assigned on 2008-02-13 UniProtKB phosphatidylserine biosynthetic process Atkinson KD, et al. (1980) Yeast mutants auxotrophic for choline or ethanolamine. J Bacteriol 141(2):558-64      IMP : Inferred from Mutant Phenotype Assigned on 2005-08-03 SGD Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD Bae-Lee MS and Carman GM (1984) Phosphatidylserine synthesis in Saccharomyces cerevisiae. Purification and characterization of membrane-associated phosphatidylserine synthase. J Biol Chem 259(17):10857-62      IDA : Inferred from Direct Assay Assigned on 2005-08-03 SGD phospholipid biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000462 , EBI:IPR004533 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0594 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0095 Assigned on 2008-02-13 UniProtKB extrinsic to membrane GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9903 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000462 , EBI:IPR004533 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB microsome GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0492 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0166 Assigned on 2008-02-13 UniProtKB mitochondrial outer membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-1000 Assigned on 2009-06-29 UniProtKB mitochondrion GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0496 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
phosphatidic acid and phospholipid biosynthesis phospholipid biosynthesis superpathway of phospholipid biosynthesis

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forCHO1/YER026C for CHO1 1) Yamashita S and Nikawa J (1997) Phosphatidylserine synthase from yeast. Biochim Biophys Acta 1348(1-2):228-35      2) Letts VA, et al. (1983) Isolation of the yeast structural gene for the membrane-associated enzyme phosphatidylserine synthase. Proc Natl Acad Sci U S A 80(23):7279-83      3) Atkinson KD, et al. (1980) Yeast mutants auxotrophic for choline or ethanolamine. J Bacteriol 141(2):558-64      4) Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    5) Bae-Lee MS and Carman GM (1984) Phosphatidylserine synthesis in Saccharomyces cerevisiae. Purification and characterization of membrane-associated phosphatidylserine synthase. J Biol Chem 259(17):10857-62

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for CHO1/YER026C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for CHO1/YER026C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MVESDED C-term SLKIPKP Length(aa) 276 MW(Da) 30,804 pI 6.23 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.147   Codon Adaptation Index 0.177   Frequency of Optimal Codons 0.487   Hydropathicity of Protein 0.165   Aromaticity Score 0.116	10 20 30 40 50 | | | | | MVESDEDFAPQEFPHTDTDVIVNEHRDENDGYASDEVGGTLSRRASSIFS INTTPLAPPNATDIQKFTSDEHHFSMMRNLHMADYITMLNGFSGFYSIVS CLRFTLTGKPHYVQRAHFFILLGMCFDFLDGRVARLRNRSSLMGQELDSL ADLVSFGVAPAAIAFAIGFQTTFDVMILSFFVLCGLARLARFNVTVAQLP KDSSTGKSKYFEGLPMPTTLALVLGMAYCVRKGLIFDNIPFGIFREDQIL EFHPIILVFFIHGCGMISKSLKIPKP*

Protein Structures from PDB: proteins of known structure with sequence similarity to CHO1/YER026C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
CHO1	Letts VA, et al. (1983) Isolation of the yeast structural gene for the membrane-associated enzyme phosphatidylserine synthase. Proc Natl Acad Sci U S A 80(23):7279-83

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YER026C	SGD Systematic Sequence
856748	NCBI: Gene ID
NP_010943.1	NCBI: RefSeq protein version ID
NP_010943.1	NCBI: RefSeq protein version ID
6320864	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
76 curated references; 0 references not yet curated
Strains/Constructs Techniques and Reagents	Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif	|AAC1 |AAC3 |ADP1 |ALG3 |ALG7 |BOR1 |DGA1 |DPP1 |ENA5 |EPT1 |GPT2 |LPP1 |NFT1 |PDR10 |MORE
Reviews	Eide DJ (2009) Homeostatic and Adaptive Responses to Zinc Deficiency in Saccharomyces cerevisiae. J Biol Chem 284(28):18565-9	|ADH1 |ADH2 |ADH3 |ADH4 |CHO2 |CKI1 |CTT1 |DPP1 |EKI1 |FET4 |HPF1 |MCD4 |MET14 |MET16 |MORE
Regulation of Strains/Constructs Transcription	Fernandez-Murray JP, et al. (2009) NTE1-encoded phosphatidylcholine phospholipase b regulates transcription of phospholipid biosynthetic genes. J Biol Chem 284(52):36034-46	|BCK1 |HAC1 |HNM1 |IES6 |INO1 |INO80 |IRE1 |NTE1 |OPI1 |PCT1 |SCS2 |SCS22 |SCS3 |SLT2 |MORE
Regulation of Transcription	Jani NM and Lopes JM (2009) Regulated transcription of the Saccharomyces cerevisiae phosphatidylinositol biosynthetic gene, PIS1, yields pleiotropic effects on phospholipid synthesis. FEMS Yeast Res 9(4):552-64	|INO1 |INO2 |PIS1
Reviews	Riekhof WR and Voelker DR (2009) The yeast plasma membrane P(4)-ATPases are major transporters for lysophospholipids. Biochim Biophys Acta 1791(7):620-7	|CDC50 |CHO2 |DNF1 |DNF2 |DNF3 |DRS2 |LEM3 |NEO1 |OPI3 |PDS1 |RET1 |YNR048W
Regulation of Transcription	Vachova L, et al. (2009) Metabolic diversification of cells during the development of yeast colonies. Environ Microbiol 11(2):494-504	|ADY2 |ARG1 |ARG3 |ATO2 |ATO3 |CAT2 |CCW12 |CHA1 |CHO2 |CIT2 |CIT3 |CTR1 |CTT1 |DAL7 |MORE
Protein-protein Interactions	Huthmacher C, et al. (2008) A computational analysis of protein interactions in metabolic networks reveals novel enzyme pairs potentially involved in metabolic channeling. J Theor Biol 252(3):456-64	|ACC1 |ADE3 |ALD6 |APA1 |APA2 |ARO1 |ARO10 |CDC19 |CHA1 |ERG25 |ERG27 |FAS1 |FAS2 |GDH1 |MORE
Reviews	Sugimoto H, et al. (2008) Transcriptional regulation of phosphatidylcholine biosynthesis. Prog Lipid Res 47(3):204-20	|CDS1 |CHO2 |CPT1 |EPT1 |INO1 |INO2 |INO4 |OPI1 |OPI3 |PSD1 |PSD2
Reviews	Carman GM and Han GS (2007) Regulation of phospholipid synthesis in Saccharomyces cerevisiae by zinc depletion. Biochim Biophys Acta 1771(3):322-30	|CDS1 |CHO2 |CKI1 |CPT1 |CRD1 |DPP1 |EKI1 |EPT1 |INM1 |INO1 |OPI1 |OPI3 |PAH1 |PCT1 |MORE
RNA Levels and Processing Regulation of	Choi HS and Carman GM (2007) Respiratory deficiency mediates the regulation of CHO1-encoded phosphatidylserine synthase by mRNA stability in Saccharomyces cerevisiae. J Biol Chem 282(43):31217-27	|CCR4 |CKI1 |COX4 |DCP1 |EKI1 |EPT1 |KEM1 |MUQ1
Regulation of Transcription	Feddersen S, et al. (2007) Transcriptional regulation of phospholipid biosynthesis is linked to fatty acid metabolism by an acyl-CoA-binding-protein-dependent mechanism in Saccharomyces cerevisiae. Biochem J 407(2):219-230	|ACB1 |ACC1 |CHO2 |CTT1 |DDR2 |FAS1 |FAS2 |GPD1 |HNM1 |HSP12 |INO1 |ITR1 |OLE1 |OPI1 |MORE
Protein Physical Properties	White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36	|ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |COS7 |COS8 |MORE
Reviews	Choi JY, et al. (2006) Macromolecular assemblies regulate nonvesicular phosphatidylserine traffic in yeast. Biochem Soc Trans 34(Pt 3):404-8	|CHO2 |MET30 |MET4 |OPI3 |PSD1 |PSD2 |STT4
Regulation of Transcription	Jesch SA, et al. (2006) Multiple endoplasmic reticulum-to-nucleus signaling pathways coordinate phospholipid metabolism with gene expression by distinct mechanisms. J Biol Chem 281(33):24070-83	|ACC1 |CDS1 |CKI1 |CPT1 |FAA4 |FAS1 |FAS2 |HAC1 |INO1 |INO2 |ITR1 |KAR2 |MGA2 |OLE1 |MORE
Protein Processing/Modification/Regulation	Mirzaei H and Regnier F (2006) Enrichment of carbonylated peptides using Girard P reagent and strong cation exchange chromatography. Anal Chem 78(3):770-8	|ALA1 |ATP1 |AVL9 |AVO1 |AYT1 |CAF16 |CBS2 |CCT3 |CIN8 |DOA4 |ERV1 |GCN5 |HSH49 |IDP3 |MORE
Reviews	Carman GM (2005) Regulation of phospholipid synthesis in yeast by zinc. Biochem Soc Trans 33(Pt 5):1150-3	|DPP1 |INO2 |INO4 |OPI1 |PIS1
Genetic Interactions RNA Levels and Processing Regulation of	Choi HS, et al. (2004) Regulation of phospholipid synthesis in the yeast cki1Delta eki1Delta mutant defective in the Kennedy pathway. The Cho1-encoded phosphatidylserine synthase is regulated by mRNA stability. J Biol Chem 279(13):12081-7	|CKI1 |EKI1
Function/Process RNA Levels and Processing Regulation of Transcription	Iwanyshyn WM, et al. (2004) Regulation of phospholipid synthesis in Saccharomyces cerevisiae by zinc. J Biol Chem 279(21):21976-83	|ATG8 |CHO2 |INO2 |INO4 |OPI1 |PSD1 |PSD2 |ZRT1 |ZRT2
Genetic Interactions	Natarajan P, et al. (2004) Drs2p-coupled aminophospholipid translocase activity in yeast Golgi membranes and relationship to in vivo function. Proc Natl Acad Sci U S A 101(29):10614-9	|DNF1 |DNF2 |DNF3 |DRS2
Genomic expression study RNA Levels and Processing Regulation of	Parveen M, et al. (2004) Response of Saccharomyces cerevisiae to a monoterpene: evaluation of antifungal potential by DNA microarray analysis. J Antimicrob Chemother 54(1):46-55	|AAD6 |ADH5 |ADH7 |ADY2 |AGA2 |AMS1 |ARG1 |ARN2 |ATF2 |ATX1 |BCK1 |BFR1 |BSC1 |BUD7 |MORE
Regulation of	Ding D and Greenberg ML (2003) Lithium and valproate decrease the membrane phosphatidylinositol/phosphatidylcholine ratio. Mol Microbiol 47(2):373-81	|INO1 |INO2 |OPI3
DNA/RNA Sequence Features Disease Gene Related Function/Process Transcription	Ju S and Greenberg ML (2003) Valproate disrupts regulation of inositol responsive genes and alters regulation of phospholipid biosynthesis. Mol Microbiol 49(6):1595-603	|INO1 |INO2
Function/Process Mutants/Phenotypes Strains/Constructs	Birner R, et al. (2001) Roles of phosphatidylethanolamine and of its several biosynthetic pathways in Saccharomyces cerevisiae. Mol Biol Cell 12(4):997-1007	|EKI1 |PSD1
Cross-species Expression Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Rontein D, et al. (2001) Plants synthesize ethanolamine by direct decarboxylation of serine using a pyridoxal phosphate enzyme. J Biol Chem 276(38):35523-9	|PSD1 |PSD2
Regulation of	Elkhaimi M, et al. (2000) Combinatorial regulation of phospholipid biosynthetic gene expression by the UME6, SIN3 and RPD3 genes. Nucleic Acids Res 28(16):3160-7	|CHO2 |INO1 |INO2 |OPI3 |RPD3 |SIN3 |UME6
Function/Process Substrates/Ligands/Cofactors	Janssen MJ, et al. (2000) The phosphatidylcholine to phosphatidylethanolamine ratio of Saccharomyces cerevisiae varies with the growth phase. Yeast 16(7):641-50	|CHO2 |INO1 |OPI3
Alias Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Nakamura H, et al. (2000) Phosphatidylserine synthesis required for the maximal tryptophan transport activity in Saccharomyces cerevisiae. Biosci Biotechnol Biochem 64(1):167-72	|TAT1 |TAT2 |TRP1
Regulation of	Robinson KA, et al. (2000) A network of yeast basic helix-loop-helix interactions. Nucleic Acids Res 28(22):4460-6	|APL2 |BCK2 |HCS1 |INO2 |INO4 |PHO4 |PRM1 |RTG1 |RTG3 |TYE7 |YLR422W |YMR317W |YNR064C
Cross-species Expression Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Delhaize E, et al. (1999) Cloning and expression of a wheat (Triticum aestivum L.) phosphatidylserine synthase cDNA. Overexpression in plants alters the composition of phospholipids. J Biol Chem 274(11):7082-8
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kaur R and Bachhawat AK (1999) The yeast multidrug resistance pump, Pdr5p, confers reduced drug resistance in erg mutants of Saccharomyces cerevisiae. Microbiology 145 ( Pt 4)():809-18	|ERG2 |ERG3 |ERG4 |ERG6 |PDR5
Regulation of	Cok SJ, et al. (1998) Transcription of INO2 and INO4 is regulated by the state of protein N-myristoylation in Saccharomyces cerevisiae. Nucleic Acids Res 26(12):2865-72	|FAS1 |INO2 |INO4 |NMT1 |OPI1
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |ERG1 |MORE
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features	Williams JG and McMaster CR (1998) Scanning alanine mutagenesis of the CDP-alcohol phosphotransferase motif of Saccharomyces cerevisiae cholinephosphotransferase. J Biol Chem 273(22):13482-7	|CPT1 |EPT1 |PIS1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Yon JO, et al. (1998) Incorporation of extracellular phospholipids and their effect on the growth and lipid metabolism of the Saccharomyces cerevisiae cho1/pss mutant. Biochim Biophys Acta 1394(1):23-32
Regulation of	Shen H and Dowhan W (1997) Regulation of phospholipid biosynthetic enzymes by the level of CDP-diacylglycerol synthase activity. J Biol Chem 272(17):11215-20	|CDS1 |INO1 |INO2 |OPI1 |PIS1
Reviews Selected Review	Yamashita S and Nikawa J (1997) Phosphatidylserine synthase from yeast. Biochim Biophys Acta 1348(1-2):228-35
Reviews	Carman GM and Zeimetz GM (1996) Regulation of phospholipid biosynthesis in the yeast Saccharomyces cerevisiae. J Biol Chem 271(23):13293-6	|CDS1 |CKI1 |CPT1 |EPT1
RNA Levels and Processing Regulation of	Jackson JC and Lopes JM (1996) The yeast UME6 gene is required for both negative and positive transcriptional regulation of phospholipid biosynthetic gene expression. Nucleic Acids Res 24(7):1322-9	|CHO2 |INO1 |INO2 |OPI1 |OPI3 |UME6
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Janitor M, et al. (1996) The pel1 mutant of Saccharomyces cerevisiae is deficient in cardiolipin and does not survive the disruption of the CHO1 gene encoding phosphatidylserine synthase. FEMS Microbiol Lett 140(1):43-7	|PGS1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Min-Seok R, et al. (1996) Isolation and characterization of ECT1 gene encoding CTP: phosphoethanolamine cytidylyltransferase of Saccharomyces cerevisiae. J Biochem 120(5):1040-7	|MUQ1
Archived Literature	Ashburner BP and Lopes JM (1995) Regulation of yeast phospholipid biosynthetic gene expression in response to inositol involves two superimposed mechanisms. Proc Natl Acad Sci U S A 92(21):9722-6	|INO1 |INO2 |OPI1
Cellular Location	Gaigg B, et al. (1995) Characterization of a microsomal subfraction associated with mitochondria of the yeast, Saccharomyces cerevisiae. Involvement in synthesis and import of phospholipids into mitochondria. Biochim Biophys Acta 1234(2):214-20	|PIS1
Archived Literature	Janitor M, et al. (1995) Molecular characterization of the PEL1 gene encoding a putative phosphatidylserine synthase. Yeast 11(13):1223-31	|PGS1
Function/Process Substrates/Ligands/Cofactors	Wu WI, et al. (1995) Regulation of lipid biosynthesis in Saccharomyces cerevisiae by fumonisin B1. J Biol Chem 270(22):13171-8	|AUR1 |DPP1 |LPP1
Archived Literature	Hamamatsu S, et al. (1994) Loss of phosphatidylserine synthesis results in aberrant solute sequestration and vacuolar morphology in Saccharomyces cerevisiae. FEBS Lett 348(1):33-6
Archived Literature	Hudak KA, et al. (1994) A pleiotropic phospholipid biosynthetic regulatory mutation in Saccharomyces cerevisiae is allelic to sin3 (sdi1, ume4, rpd1). Genetics 136(2):475-83	|CHO2 |INO1 |OPI3 |SIN3
Archived Literature	Lamping E, et al. (1994) Isolation and characterization of a mutant of Saccharomyces cerevisiae with pleiotropic deficiencies in transcriptional activation and repression. Genetics 137(1):55-65	|DEP1 |INO1 |OPI3 |PHO5 |RPD3 |SIN3 |SPT10 |SPT21
Archived Literature	Li Z and Brendel M (1993) Co-regulation with genes of phospholipid biosynthesis of the CTR/HNM1-encoded choline/nitrogen mustard permease in Saccharomyces cerevisiae. Mol Gen Genet 241(5-6):680-4	|HNM1 |INO1 |INO2 |INO4 |OPI1
Archived Literature	Bailis AM, et al. (1992) Cis and trans regulatory elements required for regulation of the CHO1 gene of Saccharomyces cerevisiae. Nucleic Acids Res 20(6):1411-8	|INO2 |INO4 |OPI1
Fungal Related Genes/Proteins	Gaynor PM and Greenberg ML (1992) Regulation of CDP-diacylglycerol synthesis and utilization by inositol and choline in Schizosaccharomyces pombe. J Bacteriol 174(17):5711-8	|CHO2
Reviews	Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|ACC1 |ACH1 |CDS1 |CHO2 |CKI1 |CTR1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |MORE
Reviews	Kent C, et al. (1991) Regulation of eukaryotic phospholipid metabolism. FASEB J 5(9):2258-66
DNA/RNA Sequence Features Mutants/Phenotypes Strains/Constructs	Kodaki T, et al. (1991) Functional analysis of the regulatory region of the yeast phosphatidylserine synthase gene, PSS. J Bacteriol 173(24):7992-5
Archived Literature	Li ZY, et al. (1991) Hyper-resistance to nitrogen mustard in Saccharomyces cerevisiae is caused by defective choline transport. Curr Genet 19(6):423-7	|HNM1
Function/Process Protein Processing/Modification/Regulation Substrates/Ligands/Cofactors	Bae-Lee M and Carman GM (1990) Regulation of yeast phosphatidylserine synthase and phosphatidylinositol synthase activities by phospholipids in Triton X-100/phospholipid mixed micelles. J Biol Chem 265(13):7221-6	|PIS1
DNA/RNA Sequence Features Protein Physical Properties Protein Sequence Features Strains/Constructs	Sperka-Gottlieb C, et al. (1990) The hydrophilic and acidic N-terminus of the integral membrane enzyme phosphatidylserine synthase is required for efficient membrane insertion. Yeast 6(4):331-43
Archived Literature Mutants/Phenotypes Strains/Constructs	Hikiji T, et al. (1988) Disruption of the CHO1 gene encoding phosphatidylserine synthase in Saccharomyces cerevisiae. J Biochem 104(6):894-900
Mutants/Phenotypes Protein Physical Properties Protein Processing/Modification/Regulation Regulation of Strains/Constructs Substrates/Ligands/Cofactors	Kelley MJ, et al. (1988) Regulation of phospholipid biosynthesis in Saccharomyces cerevisiae by inositol. Inositol is an inhibitor of phosphatidylserine synthase activity. J Biol Chem 263(34):18078-85	|PIS1
Protein Processing/Modification/Regulation Protein Sequence Features Regulation of Strains/Constructs	Kinney AJ and Carman GM (1988) Phosphorylation of yeast phosphatidylserine synthase in vivo and in vitro by cyclic AMP-dependent protein kinase. Proc Natl Acad Sci U S A 85(21):7962-6	|BCY1 |CYR1 |TPK1 |TPK2 |TPK3
Archived Literature Cellular Location Strains/Constructs	Kohlwein SD, et al. (1988) Identification of mitochondrial and microsomal phosphatidylserine synthase in Saccharomyces cerevisiae as the gene product of the CHO1 structural gene. J Bacteriol 170(8):3778-81
Archived Literature	Bailis AM, et al. (1987) The membrane-associated enzyme phosphatidylserine synthase is regulated at the level of mRNA abundance. Mol Cell Biol 7(1):167-76	|INO2 |INO4 |OPI1
Archived Literature	Kiyono K, et al. (1987) Primary structure and product characterization of the Saccharomyces cerevisiae CHO1 gene that encodes phosphatidylserine synthase. J Biochem 102(5):1089-100	|PHO5
DNA/RNA Sequence Features Protein Physical Properties RNA Levels and Processing	Nikawa J, et al. (1987) Nucleotide sequence and characterization of the yeast PSS gene encoding phosphatidylserine synthase. Eur J Biochem 167(1):7-12
Cellular Location	Kuchler K, et al. (1986) Subcellular and submitochondrial localization of phospholipid-synthesizing enzymes in Saccharomyces cerevisiae. J Bacteriol 165(3):901-10	|CDS1 |CPT1 |GAT1 |PIS1 |PSD1 |PSD2
Archived Literature	Poole MA, et al. (1986) Regulation of phosphatidylserine synthase from Saccharomyces cerevisiae by phospholipid precursors. J Bacteriol 168(2):668-72	|OPI1
Archived Literature	Atkinson KD (1985) Two recessive suppressors of Saccharomyces cerevisiae cho1 that are unlinked but fall in the same complementation group. Genetics 111(1):1-6	|EAM1 |EAM2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Atkinson KD (1984) SACCHAROMYCES CEREVISIAE Recessive Suppressor That Circumvents Phosphatidylserine Deficiency. Genetics 108(3):533-543	|EAM1
Function/Process Protein Physical Properties Substrates/Ligands/Cofactors	Bae-Lee MS and Carman GM (1984) Phosphatidylserine synthesis in Saccharomyces cerevisiae. Purification and characterization of membrane-associated phosphatidylserine synthase. J Biol Chem 259(17):10857-62
Substrates/Ligands/Cofactors	Itoh N, et al. (1984) Messenger RNA guanlyltransferase from Saccharomyces cerevisiae. II. Catalytic properties. J Biol Chem 259(22):13930-6	|CEG1 |CET1
Archived Literature	Letts VA, et al. (1983) Isolation of the yeast structural gene for the membrane-associated enzyme phosphatidylserine synthase. Proc Natl Acad Sci U S A 80(23):7279-83
Protein Physical Properties Regulation of Substrates/Ligands/Cofactors Techniques and Reagents	Carson MA, et al. (1982) Properties of particulate and solubilized phosphatidylserine synthase activity from Saccharomyces cerevisiae. Inhibitory effect of choline in the growth medium. J Biol Chem 257(14):8115-21
Archived Literature	Nikawa J and Yamashita S (1982) Yeast mutant defective in synthesis of phosphatidylinositol. Isolation and characterization of a CDPdiacylglycerol--inositol 3-phosphatidyltransferase Km mutant. Eur J Biochem 125(2):445-51	|HOM3 |PIS1 |URA3
Archived Literature	Trivedi A, et al. (1982) Effect of phophatidylcholine and phosphatidylethanolamine enrichment on the structure and function of yeast membrane. Biochim Biophys Acta 692(2):202-9
Archived Literature	Matsumoto K, et al. (1981) Isolation and characterization of dominant mutations resistant to carbon catabolite repression of galactokinase synthesis in Saccharomyces cerevisiae. Mol Cell Biol 1(2):83-93	|GAL1 |GAL10 |GAL83 |GCN4 |URA3
Archived Literature	Atkinson K, et al. (1980) Yeast mutant defective in phosphatidylserine synthesis. J Biol Chem 255(14):6653-61
Archived Literature	Atkinson KD, et al. (1980) Yeast mutants auxotrophic for choline or ethanolamine. J Bacteriol 141(2):558-64	|HIS1 |HOM3 |URA3

Return to SGD

Send a Message to the SGD Curators