---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

AVT2/YEL064C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrV: 31239 to 29797 CDS: 31239 - 29797 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
AVT2	YEL064C		ORF, Verified	S000000790
Description
Putative transporter, member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By transporter activity Russnak R, et al. (2001) A family of yeast proteins mediating bidirectional vacuolar amino acid transport. J Biol Chem 276(26):23849-57        ISS : Inferred from Sequence or structural Similarity with GenBank/EMBL/DDBJ:AF030253 Assigned on 2003-01-27 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By amino acid transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0029 Assigned on 2007-05-23 UniProtKB transport Russnak R, et al. (2001) A family of yeast proteins mediating bidirectional vacuolar amino acid transport. J Biol Chem 276(26):23849-57        ISS : Inferred from Sequence or structural Similarity with GenBank/EMBL/DDBJ:AF030253 Assigned on 2006-07-24 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Russnak R, et al. (2001) A family of yeast proteins mediating bidirectional vacuolar amino acid transport. J Biol Chem 276(26):23849-57        IDA : Inferred from Direct Assay Assigned on 2006-07-24 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB vacuole GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0926 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forAVT2/YEL064C for AVT2 1) Russnak R, et al. (2001) A family of yeast proteins mediating bidirectional vacuolar amino acid transport. J Biol Chem 276(26):23849-57

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for AVT2/YEL064C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for AVT2/YEL064C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSELGEY C-term DGQHCQI Length(aa) 480 MW(Da) 53,323 pI 8.46 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.047   Codon Adaptation Index 0.120   Frequency of Optimal Codons 0.442   Hydropathicity of Protein 0.388   Aromaticity Score 0.100

10 20 30 40 50 | | | | | MSELGEYSKLENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITPD MDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGG LLSYVALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTN GLFAFGGCIGYCIIIGDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTF ISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKL SDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISII ISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTT FPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGI SLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKSWKERLPFYLC ICFGFMIMIISSTQTIIDAVNGSDGQHCQI*

Protein Structures from PDB: proteins of known structure with sequence similarity to AVT2/YEL064C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
AVT2	Russnak R, et al. (2001) A family of yeast proteins mediating bidirectional vacuolar amino acid transport. J Biol Chem 276(26):23849-57        SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YEL064C	SGD Systematic Sequence
NP_010850.1	NCBI: RefSeq protein version ID
NP_010850.1	NCBI: RefSeq protein version ID
856645	NCBI: Gene ID
6320771	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
6 curated references; 0 references not yet curated
Protein-protein Interactions	Friedel CC, et al. (2009) Bootstrapping the interactome: unsupervised identification of protein complexes in yeast. J Comput Biol 16(8):971-87	|CDC73 |CHD1 |CKA1 |CKA2 |CKB1 |CKB2 |CPR1 |CTR9 |GUP1 |HOS2 |HOS4 |HST1 |LEO1 |MNR2 |MORE
DNA/RNA Sequence Features Reviews	Hood HM, et al. (2009) Evolutionary roles of upstream open reading frames in mediating gene regulation in fungi. Annu Rev Microbiol 63:385-409	|APC2 |ARV1 |CAD1 |CBS1 |CLN3 |CPA1 |DCD1 |ECM7 |FOL1 |GCN4 |HAP4 |HEM3 |HOL1 |IMD4 |MORE
Reviews	Sekito T, et al. (2008) Novel families of vacuolar amino acid transporters. IUBMB Life 60(8):519-25	|ATG22 |AVT1 |AVT3 |AVT4 |AVT5 |AVT6 |AVT7 |AZR1 |ERS1 |SGE1 |UGA4 |VBA1 |VBA2 |VBA3 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
DNA/RNA Sequence Features	Zhang Z and Dietrich FS (2005) Identification and characterization of upstream open reading frames (uORF) in the 5' untranslated regions (UTR) of genes in Saccharomyces cerevisiae. Curr Genet 48(2):77-87	|APC2 |ARV1 |CPA1 |ECM7 |FOL1 |GCN4 |HAP4 |HEM3 |IMD4 |MBR1 |MKK1 |RPC11 |SLM2 |SPE4 |MORE
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs Substrates/Ligands/Cofactors	Russnak R, et al. (2001) A family of yeast proteins mediating bidirectional vacuolar amino acid transport. J Biol Chem 276(26):23849-57	|AVT1 |AVT3 |AVT4 |AVT5 |AVT6 |AVT7

Return to SGD

Send a Message to the SGD Curators