---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

YEA4/YEL004W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrV: 146950 to 147978 CDS: 146950 - 147978 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
YEA4	YEL004W		ORF, Verified	S000000730
Description
Uridine diphosphate-N-acetylglucosamine (UDP-GlcNAc) transporter required for cell wall chitin synthesis; localized to the ER

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By UDP-N-acetylglucosamine transmembrane transporter activity Roy SK, et al. (2000) Characterization of Yeast Yea4p, a uridine diphosphate-N-acetylglucosamine transporter localized in the endoplasmic reticulum and required for chitin synthesis. J Biol Chem 275(18):13580-7        IMP : Inferred from Mutant Phenotype Assigned on 2009-01-14 SGD nucleotide-sugar transmembrane transporter activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004689 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By UDP-N-acetylglucosamine transport Roy SK, et al. (2000) Characterization of Yeast Yea4p, a uridine diphosphate-N-acetylglucosamine transporter localized in the endoplasmic reticulum and required for chitin synthesis. J Biol Chem 275(18):13580-7        IMP : Inferred from Mutant Phenotype Assigned on 2009-01-14 SGD UDP-glucose transport Esther CR Jr, et al. (2008) Similarities between UDP-glucose and adenine nucleotide release in yeast: involvement of the secretory pathway. Biochemistry 47(35):9269-78        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction with SGD:YMD8 Assigned on 2009-03-11 SGD carbohydrate transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0762 Assigned on 2008-02-14 UniProtKB cell wall chitin biosynthetic process Roy SK, et al. (2000) Characterization of Yeast Yea4p, a uridine diphosphate-N-acetylglucosamine transporter localized in the endoplasmic reticulum and required for chitin synthesis. J Biol Chem 275(18):13580-7        IMP : Inferred from Mutant Phenotype Assigned on 2009-01-14 SGD nucleotide-sugar transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004689 Assigned on 2007-05-23 UniProtKB translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transmembrane transport Roy SK, et al. (2000) Characterization of Yeast Yea4p, a uridine diphosphate-N-acetylglucosamine transporter localized in the endoplasmic reticulum and required for chitin synthesis. J Biol Chem 275(18):13580-7        IMP : Inferred from Mutant Phenotype Assigned on 2009-01-14 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR013657 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Roy SK, et al. (2000) Characterization of Yeast Yea4p, a uridine diphosphate-N-acetylglucosamine transporter localized in the endoplasmic reticulum and required for chitin synthesis. J Biol Chem 275(18):13580-7        IDA : Inferred from Direct Assay Assigned on 2009-01-14 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0095 Assigned on 2008-02-13 UniProtKB integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004689 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0162 Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forYEA4/YEL004W for YEA4 1) Roy SK, et al. (2000) Characterization of Yeast Yea4p, a uridine diphosphate-N-acetylglucosamine transporter localized in the endoplasmic reticulum and required for chitin synthesis. J Biol Chem 275(18):13580-7

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for YEA4/YEL004W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for YEA4/YEL004W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MWNSLKA C-term GAIKKSK Length(aa) 342 MW(Da) 39,266 pI 10.21 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.053   Codon Adaptation Index 0.101   Frequency of Optimal Codons 0.383   Hydropathicity of Protein 0.377   Aromaticity Score 0.152	10 20 30 40 50 | | | | | MWNSLKAFALVFGGCCSNVITFETLMSNETGSINNLITFCQFLFVTCQGL PEFLDVHQPFPYFKPLKTPLHVYVITVVLFYISSTTNNNVFKYNISIPIH IVFRCFGTVITMFTCWLLNGRKYTKIQILSTLFLTIGAIIASLFKDADFR YQDLKLQAWKIGSDQSVDLTFIFGICILVLSSFTSSLLSAYNERTYQKYG KHWKENIFYSHFLSLPLFLFSRKQLIHEYRVMRKSERILCSNFGGKILVP REETLLLFNVLTQYFCVKGVNILASKTNALTLSITLLVRKFISLLLSVRL FDNNLSYTGYIGVYLVFFGAFIYSLGSIHPRQNDKGAIKKSK*

Protein Structures from PDB: proteins of known structure with sequence similarity to YEA4/YEL004W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
YEA4	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YEL004W	SGD Systematic Sequence
NP_010912.1	NCBI: RefSeq protein version ID
NP_010912.1	NCBI: RefSeq protein version ID
856714	NCBI: Gene ID
6320833	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
8 curated references; 0 references not yet curated
Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Sesma JI, et al. (2009) Endoplasmic Reticulum/Golgi Nucleotide Sugar Transporters Contribute to the Cellular Release of UDP-sugar Signaling Molecules. J Biol Chem 284(18):12572-83
Genetic Interactions	Esther CR Jr, et al. (2008) Similarities between UDP-glucose and adenine nucleotide release in yeast: involvement of the secretory pathway. Biochemistry 47(35):9269-78	|HUT1 |YMD8
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Evolution Non-Fungal Related Genes/Proteins	Tischler J, et al. (2006) Combinatorial RNA interference in Caenorhabditis elegans reveals that redundancy between gene duplicates can be maintained for more than 80 million years of evolution. Genome Biol 7(8):R69	|AAT2 |AGC1 |AIP1 |ALE1 |APM1 |ARC15 |BNA3 |BNA4 |BSC1 |BZZ1 |CDC36 |CDC53 |CKS1 |CMD1 |MORE
Cell Cycle Phase Involved Mutants/Phenotypes	Zettel MF, et al. (2003) The budding index of Saccharomyces cerevisiae deletion strains identifies genes important for cell cycle progression. FEMS Microbiol Lett 223(2):253-8	|ACM1 |AFR1 |ALG5 |ARX1 |ATP15 |BEM1 |BEM4 |BUB1 |BUR2 |CLB2 |CTF4 |CTF8 |CWP1 |DCC1 |MORE
Cellular Location Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents	Roy SK, et al. (2000) Characterization of Yeast Yea4p, a uridine diphosphate-N-acetylglucosamine transporter localized in the endoplasmic reticulum and required for chitin synthesis. J Biol Chem 275(18):13580-7
Fungal Related Genes/Proteins	Dean N, et al. (1997) The VRG4 gene is required for GDP-mannose transport into the lumen of the Golgi in the yeast, Saccharomyces cerevisiae. J Biol Chem 272(50):31908-14	|HVG1 |VRG4 |YMD8

Return to SGD

Send a Message to the SGD Curators