---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

WBP1/YEL002C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrV: 150013 to 148721 CDS: 150013 - 148721 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
WBP1	YEL002C		ORF, Verified	S000000728
Description
Beta subunit of the oligosaccharyl transferase (OST) glycoprotein complex; required for N-linked glycosylation of proteins in the endoplasmic reticulum

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By dolichyl-diphosphooligosaccharide-protein glycotransferase activity Karaoglu D, et al. (1997) The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p. J Biol Chem 272(51):32513-20        IPI : Inferred from Physical Interaction Assigned on 2002-10-01 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR005013 Assigned on 2007-05-23 UniProtKB GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.119 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By cell cycle te Heesen S, et al. (1991) An essential 45 kDa yeast transmembrane protein reacts with anti-nuclear pore antibodies: purification of the protein, immunolocalization and cloning of the gene. Eur J Cell Biol 56(1):8-18      IDA : Inferred from Direct Assay Assigned on 2002-09-28 SGD cellular carbohydrate metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT glycoprotein metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein amino acid N-linked glycosylation Karaoglu D, et al. (1997) The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p. J Biol Chem 272(51):32513-20        IPI : Inferred from Physical Interaction Assigned on 2002-10-01 SGD protein amino acid N-linked glycosylation via asparagine DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR005013 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum te Heesen S, et al. (1991) An essential 45 kDa yeast transmembrane protein reacts with anti-nuclear pore antibodies: purification of the protein, immunolocalization and cloning of the gene. Eur J Cell Biol 56(1):8-18      IDA : Inferred from Direct Assay Assigned on 2002-09-28 SGD Scheper W, et al. (2003) Coordination of N-glycosylation and protein translocation across the endoplasmic reticulum membrane by Sss1 protein. J Biol Chem 278(39):37998-8003        IDA : Inferred from Direct Assay Assigned on 2004-11-15 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB endoplasmic reticulum membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR005013 Assigned on 2009-06-17 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9905 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB nuclear envelope te Heesen S, et al. (1991) An essential 45 kDa yeast transmembrane protein reacts with anti-nuclear pore antibodies: purification of the protein, immunolocalization and cloning of the gene. Eur J Cell Biol 56(1):8-18      IDA : Inferred from Direct Assay Assigned on 2002-09-28 SGD oligosaccharyltransferase complex Karaoglu D, et al. (1997) The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p. J Biol Chem 272(51):32513-20        IPI : Inferred from Physical Interaction Assigned on 2005-05-04 SGD Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from Saccharomyces cerevisiae. Isolation of the OST6 gene, its synthetic interaction with OST3, and analysis of the native complex. J Biol Chem 274(24):17249-56        IPI : Inferred from Physical Interaction Assigned on 2002-03-28 SGD Schwarz M, et al. (2005) Yeast oligosaccharyltransferase consists of two functionally distinct sub-complexes, specified by either the Ost3p or Ost6p subunit. FEBS Lett 579(29):6564-8        IPI : Inferred from Physical Interaction Assigned on 2006-02-03 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for WBP1/YEL002C for WBP1 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2). The oligosaccharyl transferase complex (OST complex) (EC 2.4.1.119) transfers 14-sugar branched oligosaccharides from dolichyl pyrophosphate to asparagine residues. The complex contains nine protein subunits: Ost1p, Ost2p, Ost3p, Ost4p, Ost5p, Ost6p, Stt3p, Swp1p, and Wbp1p, all of which are integral membrane proteins of the ER. The OST complex interacts with the Sec61p pore complex (3) involved in protein import into the ER. Wbp1p is the beta subunit of the OST complex, one of the original six subunits purified (4). WBP1 is essential (5, 6), but conditional mutants have decreased transferase activity (6, 7). Wbp1p is homologous to mammalian OST48 (OMIM) (8). Last Updated: 2005-07-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forWBP1/YEL002C for WBP1 1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50        2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57      3) Chavan M, et al. (2005) Subunits of the translocon interact with components of the oligosaccharyl transferase complex. J Biol Chem 280(24):22917-24        4) Kelleher DJ and Gilmore R (1994) The Saccharomyces cerevisiae oligosaccharyltransferase is a protein complex composed of Wbp1p, Swp1p, and four additional polypeptides. J Biol Chem 269(17):12908-17      5) te Heesen S, et al. (1991) An essential 45 kDa yeast transmembrane protein reacts with anti-nuclear pore antibodies: purification of the protein, immunolocalization and cloning of the gene. Eur J Cell Biol 56(1):8-18      6) te Heesen S, et al. (1992) The yeast WBP1 is essential for oligosaccharyl transferase activity in vivo and in vitro. EMBO J 11(6):2071-5      7) te Heesen S, et al. (1993) Yeast Wbp1p and Swp1p form a protein complex essential for oligosaccharyl transferase activity. EMBO J 12(1):279-84      8) Silberstein S, et al. (1992) The 48-kDa subunit of the mammalian oligosaccharyltransferase complex is homologous to the essential yeast protein WBP1. J Biol Chem 267(33):23658-63

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for WBP1/YEL002C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for WBP1/YEL002C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MRTDWNF C-term ETFKKTN Length(aa) 430 MW(Da) 49,391 pI 5.76 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.101   Codon Adaptation Index 0.174   Frequency of Optimal Codons 0.477   Hydropathicity of Protein -0.332   Aromaticity Score 0.133

10 20 30 40 50 | | | | | MRTDWNFFFCILLQAIFVVGTQTSRTLVLYDQSTEPLEEYSVYLKDLEQR NYKLEYLDINSTSTTVDLYDKEQRLFDNIIVFPTKGGKNLARQIPVKQLI KFFENEGNILCMSSPGAVPNTIRLFLNELGIYPSPKGHVIRDYFSPSSEE LVVSSNHLLNKYVYNARKSEDFVFGESSAALLENREQIVPILNAPRTSFT ESKGKCNSWTSGSQGFLVVGFQNLNNARLVWIGSSDFLKNKNQDSNQEFA KELLKWTFNEKSVIKSVHAVHSHADGTSYDEEPYKIKDKVIYSVGFSEWN GEEWLPHIADDIQFELRQVDPYYRLTLSPSGNDSETQYYTTGEFILPDRH GVFTFLTDYRKIGLSFTTDKDVKAIRHLANDEYPRSWEISNSWVYISAIC GVIVAWIFFVVSFVTTSSVGKKLETFKKTN*

Protein Structures from PDB: proteins of known structure with sequence similarity to WBP1/YEL002C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
WBP1	te Heesen S, et al. (1991) An essential 45 kDa yeast transmembrane protein reacts with anti-nuclear pore antibodies: purification of the protein, immunolocalization and cloning of the gene. Eur J Cell Biol 56(1):8-18

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YEL002C	SGD Systematic Sequence
NP_010914.1	NCBI: RefSeq protein version ID
NP_010914.1	NCBI: RefSeq protein version ID
856716	NCBI: Gene ID
6320835	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
65 curated references; 0 references not yet curated
Other Features	Connerth M, et al. (2009) Analysis of lipid particles from yeast. Methods Mol Biol 579:359-74	|AYR1 |ERG1 |ERG6 |ERG7 |POR1 |PRC1 |SEC61
Protein Physical Properties Protein-protein Interactions Techniques and Reagents	Harada Y, et al. (2009) Oligosaccharyltransferase directly binds to ribosome at a location near the translocon-binding site. Proc Natl Acad Sci U S A 106(17):6945-9	|NIP7 |NMD3 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |RDN25-1 |RDN25-2 |RDN5-1 |RDN5-2 |RDN5-3 |RDN5-4 |MORE
Cross-species Expression Mutants/Phenotypes Strains/Constructs	Hese K, et al. (2009) The yeast oligosaccharyltransferase complex can be replaced by STT3 from Leishmania major. Glycobiology 19(2):160-171	|OST1 |OST2 |STT3 |SWP1
Computational analysis Large-scale protein interaction	Wu M, et al. (2009) A core-attachment based method to detect protein complexes in PPI networks. BMC Bioinformatics 10:169	|DAD1 |DAM1 |GPI2 |HAP2 |HAP3 |HAP5 |MTH1 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |PEP3 |MORE
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Techniques and Reagents	Czabany T, et al. (2008) Structural and Biochemical Properties of Lipid Particles from the Yeast Saccharomyces cerevisiae. J Biol Chem 283(25):17065-17074	|ARE1 |ARE2 |DGA1 |ERG1 |LRO1 |POR1 |PRC1
Fungal Related Genes/Proteins	Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hauptmann P and Lehle L (2008) Kex1 protease is involved in yeast cell death induced by defective N-glycosylation, acetic Acid, and chronological aging. J Biol Chem 283(27):19151-63	|KEX1 |MCA1
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |MORE
Protein/Nucleic Acid Structure Strains/Constructs Techniques and Reagents	Li H, et al. (2008) Structure of the oligosaccharyl transferase complex at 12 a resolution. Structure 16(3):432-40	|OST1 |STT3 |SWP1
Cross-species Expression Mutants/Phenotypes Strains/Constructs	Nasab FP, et al. (2008) All in One: Leishmania major STT3 Proteins Substitute for the Whole Oligosaccharyltransferase Complex in Saccharomyces cerevisiae. Mol Biol Cell 19(9):3758-3768	|OST1 |OST2 |STT3 |SWP1
Function/Process Non-Fungal Related Genes/Proteins Protein Physical Properties Substrates/Ligands/Cofactors	Kelleher DJ, et al. (2007) Dolichol-linked oligosaccharide selection by the oligosaccharyltransferase in protist and fungal organisms. J Cell Biol 177(1):29-37	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Protein Physical Properties Substrates/Ligands/Cofactors Techniques and Reagents	Kohda D, et al. (2007) New oligosaccharyltransferase assay method. Glycobiology 17(11):1175-82	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Reviews	Lennarz WJ (2007) Studies on oligosaccharyl transferase in yeast. Acta Biochim Pol 54(4):673-7	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Cellular Location Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure Techniques and Reagents	Chavan M, et al. (2006) Dimeric organization of the yeast oligosaccharyl transferase complex. Proc Natl Acad Sci U S A 103(24):8947-52	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Cross-species Expression Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hauptmann P, et al. (2006) Defects in N-glycosylation induce apoptosis in yeast. Mol Microbiol 59(3):765-78	|MCA1 |OST2
Reviews	Kelleher DJ and Gilmore R (2006) An evolving view of the eukaryotic oligosaccharyltransferase. Glycobiology 16(4):47R-62R	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Reviews	Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |MORE
Cellular Location Strains/Constructs	Voeltz GK, et al. (2006) A class of membrane proteins shaping the tubular endoplasmic reticulum. Cell 124(3):573-86	|ERG3 |ERP2 |OST1 |RTN1 |RTN2 |SEC63 |SUR2 |YOP1
Reviews	Weerapana E and Imperiali B (2006) Asparagine-linked protein glycosylation: from eukaryotic to prokaryotic systems. Glycobiology 16(6):91R-101R	|ALG1 |ALG11 |ALG13 |ALG14 |ALG2 |ALG7 |ALG9 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |RFT1 |MORE
Function/Process Protein-protein Interactions Strains/Constructs Techniques and Reagents	Chavan M, et al. (2005) Subunits of the translocon interact with components of the oligosaccharyl transferase complex. J Biol Chem 280(24):22917-24	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |SBH1 |SEC61 |SSS1 |STT3 |SWP1
Reviews	Jones J, et al. (2005) Controlling N-linked glycan site occupancy. Biochim Biophys Acta 1726(2):121-37	|MNL1 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Non-Fungal Related Genes/Proteins	Lerouxel O, et al. (2005) Mutants in DEFECTIVE GLYCOSYLATION, an Arabidopsis homolog of an oligosaccharyltransferase complex subunit, show protein underglycosylation and defects in cell differentiation and growth. Plant J 42(4):455-68
Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Strains/Constructs	Li G, et al. (2005) Studies on the N-glycosylation of the subunits of oligosaccharyl transferase in Saccharomyces cerevisiae. J Biol Chem 280(3):1864-71	|OST1 |STT3
Function/Process Genetic Interactions	Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19	|ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Cellular Location Function/Process Protein-protein Interactions	Schwarz M, et al. (2005) Yeast oligosaccharyltransferase consists of two functionally distinct sub-complexes, specified by either the Ost3p or Ost6p subunit. FEBS Lett 579(29):6564-8	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Function/Process Protein-protein Interactions	Spirig U, et al. (2005) The 3.4-kDa Ost4 protein is required for the assembly of two distinct oligosaccharyltransferase complexes in yeast. Glycobiology 15(12):1396-406	|OST1 |OST3 |OST4 |OST6 |STT3 |SWP1
Protein-protein Interactions Strains/Constructs	Yan A and Lennarz WJ (2005) Two oligosaccharyl transferase complexes exist in yeast and associate with two different translocons. Glycobiology 15(12):1407-15	|ALG1 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |SBH1 |SBH2 |SWP1
Reviews	Yan A and Lennarz WJ (2005) Unraveling the mechanism of protein N-glycosylation. J Biol Chem 280(5):3121-4	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Protein Sequence Features Strains/Constructs Techniques and Reagents	Dempski RE Jr and Imperiali B (2004) Heterologous expression and biophysical characterization of soluble oligosaccharyl transferase subunits. Arch Biochem Biophys 431(1):63-70	|OST1 |SWP1
Cellular Location Protein-protein Interactions Strains/Constructs Techniques and Reagents	Scheper W, et al. (2003) Coordination of N-glycosylation and protein translocation across the endoplasmic reticulum membrane by Sss1 protein. J Biol Chem 278(39):37998-8003	|SBH1 |SEC61 |SSS1
Cellular Location Function/Process Protein-protein Interactions Strains/Constructs	Yan A, et al. (2003) New findings on interactions among the yeast oligosaccharyl transferase subunits using a chemical cross-linker. J Biol Chem 278(35):33078-87	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Protein-protein Interactions	Park H and Lennarz WJ (2000) Evidence for interaction of yeast protein kinase C with several subunits of oligosaccharyl transferase. Glycobiology 10(7):737-44	|OST1 |OST3 |PKC1 |STT3 |SWP1
Non-Fungal Related Genes/Proteins Substrates/Ligands/Cofactors Techniques and Reagents	Eason PD and Imperiali B (1999) A potent oligosaccharyl transferase inhibitor that crosses the intracellular endoplasmic reticulum membrane. Biochemistry 38(17):5430-7	|OST3 |SWP1
Cellular Location Function/Process Protein-protein Interactions Techniques and Reagents	Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from Saccharomyces cerevisiae. Isolation of the OST6 gene, its synthetic interaction with OST3, and analysis of the native complex. J Biol Chem 274(24):17249-56	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Reviews	Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from yeast. Biochim Biophys Acta 1426(2):259-73	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1
Function/Process Mutants/Phenotypes Strains/Constructs	Mazhari-Tabrizi R, et al. (1999) Chromosomal promoter replacement in Saccharomyces cerevisiae: construction of conditional lethal strains for the cloning of glycosyltransferases from various organisms. Glycoconj J 16(11):673-9	|ALG1 |ALG7 |DPM1 |GAA1 |GPI2 |PIS1 |SEC59 |SPT14
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Burda P and Aebi M (1998) The ALG10 locus of Saccharomyces cerevisiae encodes the alpha-1,2 glucosyltransferase of the endoplasmic reticulum: the terminal glucose of the lipid-linked oligosaccharide is required for efficient N-linked glycosylation. Glycobiology 8(5):455-62	|DIE2
Cellular Location Protein Sequence Features	Nakamura N, et al. (1998) Identification of potential regulatory elements for the transport of Emp24p. Mol Biol Cell 9(12):3493-503	|EMP24
Cellular Location Protein Sequence Features Protein-protein Interactions	Schroder-Kohne S, et al. (1998) Alpha-COP can discriminate between distinct, functional di-lysine signals in vitro and regulates access into retrograde transport. J Cell Sci 111 ( Pt 23)():3459-70	|COP1 |EMP47 |RET2 |RET3 |SEC21 |SEC27
Cellular Location Function/Process Protein-protein Interactions Techniques and Reagents	Stagljar I, et al. (1998) A genetic system based on split-ubiquitin for the analysis of interactions between membrane proteins in vivo. Proc Natl Acad Sci U S A 95(9):5187-92	|ALG5 |OST1
Cellular Location Function/Process Protein-protein Interactions Techniques and Reagents	Karaoglu D, et al. (1997) The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p. J Biol Chem 272(51):32513-20	|OST1 |OST2 |OST3 |OST4 |OST5 |STT3 |SWP1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Reiss G, et al. (1997) A specific screen for oligosaccharyltransferase mutations identifies the 9 kDa OST5 protein required for optimal activity in vivo and in vitro. EMBO J 16(6):1164-72	|OST1 |OST2 |OST3 |OST5 |STT3 |SWP1
Cellular Location Function/Process Protein-protein Interactions Techniques and Reagents	Spirig U, et al. (1997) The STT3 protein is a component of the yeast oligosaccharyltransferase complex. Mol Gen Genet 256(6):628-37	|OST1 |OST3 |OST4 |STT3 |SWP1
Alias Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Burda P, et al. (1996) Stepwise assembly of the lipid-linked oligosaccharide in the endoplasmic reticulum of Saccharomyces cerevisiae: identification of the ALG9 gene encoding a putative mannosyl transferase. Proc Natl Acad Sci U S A 93(14):7160-5	|ALG3 |ALG9
Reviews	Silberstein S and Gilmore R (1996) Biochemistry, molecular biology, and genetics of the oligosaccharyltransferase. FASEB J 10(8):849-58	|OST1 |OST2 |OST3 |OST4 |OST5 |STT3 |SWP1
Mutants/Phenotypes	Dean N (1995) Yeast glycosylation mutants are sensitive to aminoglycosides. Proc Natl Acad Sci U S A 92(5):1287-91	|ALG1 |ALG2 |ALG3 |ALG5 |ANP1 |CWH41 |MNN1 |MNN10 |MNN2 |MNN9 |SEC53 |VRG4
Cellular Location Function/Process	Karaoglu D, et al. (1995) Functional characterization of Ost3p. Loss of the 34-kD subunit of the Saccharomyces cerevisiae oligosaccharyltransferase results in biased underglycosylation of acceptor substrates. J Cell Biol 130(3):567-77	|ALG5 |OST1 |OST3 |SWP1
Cellular Location Function/Process Protein Physical Properties Protein Sequence Features Protein-protein Interactions Substrates/Ligands/Cofactors	Pathak R, et al. (1995) Sulfhydryl modification of the yeast Wbp1p inhibits oligosaccharyl transferase activity. Biochemistry 34(13):4179-85	|SWP1
Cellular Location Function/Process Protein-protein Interactions	Silberstein S, et al. (1995) The alpha subunit of the Saccharomyces cerevisiae oligosaccharyltransferase complex is essential for vegetative growth of yeast and is homologous to mammalian ribophorin I. J Cell Biol 128(4):525-36	|KAR2 |OST1 |SWP1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Silberstein S, et al. (1995) The essential OST2 gene encodes the 16-kD subunit of the yeast oligosaccharyltransferase, a highly conserved protein expressed in diverse eukaryotic organisms. J Cell Biol 131(2):371-83	|OST1 |OST2 |OST3 |SWP1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Zufferey R, et al. (1995) STT3, a highly conserved protein required for yeast oligosaccharyl transferase activity in vivo. EMBO J 14(20):4949-60	|ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |DIE2 |STT3
Cellular Location Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Strains/Constructs	Gaynor EC, et al. (1994) Signal-mediated retrieval of a membrane protein from the Golgi to the ER in yeast. J Cell Biol 127(3):653-65	|OCH1 |PEP4
Cellular Location Function/Process Non-Fungal Related Genes/Proteins Protein-protein Interactions	Kelleher DJ and Gilmore R (1994) The Saccharomyces cerevisiae oligosaccharyltransferase is a protein complex composed of Wbp1p, Swp1p, and four additional polypeptides. J Biol Chem 269(17):12908-17	|OST1 |OST2 |OST3 |OST5 |SWP1
Cellular Location Non-Fungal Related Genes/Proteins Protein Physical Properties Protein-protein Interactions Techniques and Reagents	Knauer R and Lehle L (1994) The N-oligosaccharyltransferase complex from yeast. FEBS Lett 344(1):83-6	|OST1 |SWP1
Non-Fungal Related Genes/Proteins	Kumar V, et al. (1994) Purification and characterization of avian oligosaccharyltransferase. Complete amino acid sequence of the 50-kDa subunit. J Biol Chem 269(18):13451-7
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Stagljar I, et al. (1994) New phenotype of mutations deficient in glucosylation of the lipid-linked oligosaccharide: cloning of the ALG8 locus. Proc Natl Acad Sci U S A 91(13):5977-81	|ALG8
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	te Heesen S and Aebi M (1994) The genetic interaction of kar2 and wbp1 mutations. Distinct functions of binding protein BiP and N-linked glycosylation in the processing pathway of secreted proteins in Saccharomyces cerevisiae. Eur J Biochem 222(2):631-7	|KAR2 |PRC1
Reviews	Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50	|ALG1 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ANP1 |CWH41 |DPM1 |GDA1 |GFA1 |KRE2 |MNN1 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	te Heesen S, et al. (1993) Yeast Wbp1p and Swp1p form a protein complex essential for oligosaccharyl transferase activity. EMBO J 12(1):279-84	|SWP1
Non-Fungal Related Genes/Proteins	Silberstein S, et al. (1992) The 48-kDa subunit of the mammalian oligosaccharyltransferase complex is homologous to the essential yeast protein WBP1. J Biol Chem 267(33):23658-63
DNA/RNA Sequence Features Mapping	te Heesen S and Aebi M (1992) Genetic and physical mapping of the WBP1 locus close to CENV. Yeast 8(12):1101-3	|GCN4
Function/Process Mutants/Phenotypes Strains/Constructs	te Heesen S, et al. (1992) The yeast WBP1 is essential for oligosaccharyl transferase activity in vivo and in vitro. EMBO J 11(6):2071-5
Cell Cycle Phase Involved Cellular Location DNA/RNA Sequence Features Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Substrates/Ligands/Cofactors	te Heesen S, et al. (1991) An essential 45 kDa yeast transmembrane protein reacts with anti-nuclear pore antibodies: purification of the protein, immunolocalization and cloning of the gene. Eur J Cell Biol 56(1):8-18
Alias Substrates/Ligands/Cofactors	Trimble RB, et al. (1980) Effect of glucosylation of lipid intermediates on oligosaccharide transfer in solubilized microsomes from Saccharomyces cerevisiae. J Biol Chem 255(24):11892-5	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1

Return to SGD

Send a Message to the SGD Curators