---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ERS1/YCR075C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIII: 248812 to 248030 CDS: 248812 - 248030 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ERS1	YCR075C		ORF, Verified	S000000671
Description
Protein with similarity to human cystinosin, which is a H(+)-driven transporter involved in L-cystine export from lysosomes and implicated in the disease cystinosis; contains seven transmembrane domains

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By L-cystine transmembrane transporter activity Kalatzis V, et al. (2001) Cystinosin, the protein defective in cystinosis, is a H(+)-driven lysosomal cystine transporter. EMBO J 20(21):5940-9        ISS : Inferred from Sequence or structural Similarity with GenBank/EMBL/DDBJ:CAA11021 Assigned on 2007-02-09 SGD Gao XD, et al. (2005) ERS1 encodes a functional homologue of the human lysosomal cystine transporter. FEBS J 272(10):2497-511        IGI : Inferred from Genetic Interaction with GenBank/EMBL/DDBJ:CAA11021 Assigned on 2007-02-09 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By L-cystine transport Kalatzis V, et al. (2001) Cystinosin, the protein defective in cystinosis, is a H(+)-driven lysosomal cystine transporter. EMBO J 20(21):5940-9        ISS : Inferred from Sequence or structural Similarity with GenBank/EMBL/DDBJ:CAA11021 Assigned on 2007-03-13 SGD Gao XD, et al. (2005) ERS1 encodes a functional homologue of the human lysosomal cystine transporter. FEBS J 272(10):2497-511        IGI : Inferred from Genetic Interaction with GenBank/EMBL/DDBJ:CAA11021 Assigned on 2007-02-09 SGD response to water Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transmembrane transport Kalatzis V, et al. (2001) Cystinosin, the protein defective in cystinosis, is a H(+)-driven lysosomal cystine transporter. EMBO J 20(21):5940-9        ISS : Inferred from Sequence or structural Similarity with GenBank/EMBL/DDBJ:CAA11021 Assigned on 2008-12-15 SGD transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endosome Gao XD, et al. (2005) ERS1 encodes a functional homologue of the human lysosomal cystine transporter. FEBS J 272(10):2497-511        IDA : Inferred from Direct Assay Assigned on 2005-06-30 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0967 Assigned on 2008-02-14 UniProtKB fungal-type vacuole Gao XD, et al. (2005) ERS1 encodes a functional homologue of the human lysosomal cystine transporter. FEBS J 272(10):2497-511        IDA : Inferred from Direct Assay Assigned on 2007-04-30 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB vacuole GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0926 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ERS1/YCR075C for ERS1 ERS1 encodes an endosomal and vacuolar-localized seven transmembrane domain-containing cystine transporter (1, 2). Cystine, the disulfide-linked form of cysteine, is generated as a byproduct of protein hydrolysis in the vacuole, and must be exported to the cytoplasm where it is reduced to cysteine. ERS1 was originally isolated as a suppressor of an ERD1 mutation (1). ERD1 mutants are defective in the HDEL tetrapeptide-mediated retrieval and retention of lumenal endoplasmic reticulum (ER) proteins, and are also defective in Golgi-dependent glycoprotein processing (3). ERS1 deletion mutants are viable and display hygromycin B sensitivity but are not defective in the retention of ER proteins (1, 2). MEH1, a gene involved in vacuolar acidification and positive regulation of microautophagy, has been identified as a high-copy number suppressor of an ERS1 deletion (2). Cystinosin, a lysosomal H(+)-driven cystine transporter encoded by the CTNS (OMIM) locus in humans is a functional homolog of Ers1p (2, 4). The human cystinosin symporter is responsible for the export of cystine from lysosomes (4). Mutations in the CTNS gene result in several related cystinotic disorders including nephropathic cystinosis, a lysosomal storage disease characterized by the accumulation of cystine crystals in various organs including the eyes, kidneys, and liver (5). This disorder presents clinically as renal Fanconi Syndrome (OMIM), a failure of the kidneys to reabsorb nutrients and minerals that results in end-stage kidney failure (5). A strong correlation exists between the clinical severity associated with various CTNS mutant alleles identified in cystinosis patients and the degree with which these mutant alleles are able to complement an ERS1 deletion strain (2). Last Updated: 2007-02-14

Basic References [TOP]

BASIC INFORMATION REFERENCES forERS1/YCR075C for ERS1 1) Hardwick KG and Pelham HR (1990) ERS1 a seven transmembrane domain protein from Saccharomyces cerevisiae. Nucleic Acids Res 18(8):2177      2) Gao XD, et al. (2005) ERS1 encodes a functional homologue of the human lysosomal cystine transporter. FEBS J 272(10):2497-511        3) Hardwick KG, et al. (1990) ERD1, a yeast gene required for the retention of luminal endoplasmic reticulum proteins, affects glycoprotein processing in the Golgi apparatus. EMBO J 9(3):623-30      4) Kalatzis V, et al. (2001) Cystinosin, the protein defective in cystinosis, is a H(+)-driven lysosomal cystine transporter. EMBO J 20(21):5940-9        5) Town M, et al. (1998) A novel gene encoding an integral membrane protein is mutated in nephropathic cystinosis. Nat Genet 18(4):319-24

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERS1/YCR075C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERS1/YCR075C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MVSLDDI C-term LASEYPL Length(aa) 260 MW(Da) 30,116 pI 8.93 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.033   Codon Adaptation Index 0.088   Frequency of Optimal Codons 0.382   Hydropathicity of Protein 0.336   Aromaticity Score 0.158	10 20 30 40 50 | | | | | MVSLDDILGIVYVTSWSISMYPPIITNWRHKSASAISMDFVMLNTAGYSY LVISIFLQLYCWKMTGDESDLGRPKLTQFDFWYCLHGCLMNVVLLTQVVA GARIWRFPGKGHRKMNPWYLRILLASLAIFSLLTVQFMYSNYWYDWHNSR TLAYCNNLFLLKISMSLIKYIPQVTHNSTRKSMDCFPIQGVFLDVTGGIA SLLQLIWQLSNDQGFSLDTFVTNFGKVGLSMVTLIFNFIFIMQWFVYRSR GHDLASEYPL*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERS1/YCR075C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ERS1	Hardwick KG and Pelham HR (1990) ERS1 a seven transmembrane domain protein from Saccharomyces cerevisiae. Nucleic Acids Res 18(8):2177

Sequence Annotation Notes

Date	Note
2000-09-13	The systematic sequence was updated in the region between ORFs YCR073W-A and YCR075C. Note that coordinates listed are chromosomal coordinates. Old: 246675 ACATACATACATATATTTATGTATATTTATGTATATATATATATATATATAT--GCGTAA 246732 |||||||||||||||||||||||||||||||||||||||||||||||||||| |||||| New: 247943 ACATACATACATATATTTATGTATATTTATGTATATATATATATATATATATATGCGTAA 248002

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YCR075C	SGD Systematic Sequence
850438	NCBI: Gene ID
NP_010000.1	NCBI: RefSeq protein version ID
NP_010000.1	NCBI: RefSeq protein version ID
6319919	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
11 curated references; 0 references not yet curated
Disease Gene Related Fungal Related Genes/Proteins Reviews	Dijck PV (2009) Nutrient sensing G protein-coupled receptors: interesting targets for antifungals? Med Mycol1-10	|ASC1 |GPA2 |GPB1 |GPB2 |GPR1 |RTC2 |YOL092W
Reviews	Li SC and Kane PM (2009) The yeast lysosome-like vacuole: Endpoint and crossroads. Biochim Biophys Acta 1793(4):650-63	|ATG1 |ATG13 |ATG14 |ATG17 |ATG18 |ATG22 |ATG8 |AVT1 |AVT3 |AVT4 |AVT6 |BPT1 |CCC1 |CDC42 |MORE
Reviews	Sekito T, et al. (2008) Novel families of vacuolar amino acid transporters. IUBMB Life 60(8):519-25	|ATG22 |AVT1 |AVT2 |AVT3 |AVT4 |AVT5 |AVT6 |AVT7 |AZR1 |SGE1 |UGA4 |VBA1 |VBA2 |VBA3 |MORE
DNA/RNA Sequence Features RNA Levels and Processing Regulation of	Wang D, et al. (2007) Expression evolution in yeast genes of single-input modules is mainly due to changes in trans-acting factors. Genome Res 17(8):1161-9	|ADH6 |AFG1 |APP1 |ARG8 |BNA2 |CAR2 |CHO2 |CRP1 |DIS3 |DYN1 |EMP24 |GPM1 |HEM1 |HMG1 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
RNA Levels and Processing	Guo Y, et al. (2006) Analysis of cellular responses to aflatoxin B(1) in yeast expressing human cytochrome P450 1A2 using cDNA microarrays. Mutat Res 593(1-2):121-42	|AAT1 |AHA1 |ALD2 |ALD3 |ALK1 |APC1 |APC5 |APT2 |AQR1 |AQY2 |ARC40 |ARN1 |ARO10 |ARO9 |MORE
Cellular Location Cross-species Expression Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gao XD, et al. (2005) ERS1 encodes a functional homologue of the human lysosomal cystine transporter. FEBS J 272(10):2497-511	|GTR1 |MEH1
Non-Fungal Related Genes/Proteins	Cherqui S, et al. (2001) The targeting of cystinosin to the lysosomal membrane requires a tyrosine-based signal and a novel sorting motif. J Biol Chem 276(16):13314-21
Disease Gene Related Non-Fungal Related Genes/Proteins	Kalatzis V, et al. (2001) Cystinosin, the protein defective in cystinosis, is a H(+)-driven lysosomal cystine transporter. EMBO J 20(21):5940-9
Disease Gene Related Non-Fungal Related Genes/Proteins	Town M, et al. (1998) A novel gene encoding an integral membrane protein is mutated in nephropathic cystinosis. Nat Genet 18(4):319-24
Cellular Location Protein Sequence Features	Hardwick KG and Pelham HR (1990) ERS1 a seven transmembrane domain protein from Saccharomyces cerevisiae. Nucleic Acids Res 18(8):2177

Return to SGD

Send a Message to the SGD Curators