FEN1/YCR034W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIII: 190588 to 191631
CDS: 190588 - 191631
Genetic position: 24 cM
Genetic Map Data

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

FEN1 YCR034W ELO2, GNS1, VBM2 ORF, Verified S000000630

Description
Fatty acid elongase, involved in sphingolipid biosynthesis; acts on fatty acids of up to 24 carbons in length; mutations have regulatory effects on 1,3-beta-glucan synthase, vacuolar ATPase, and the secretory pathway

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
fatty acid elongase activity Rossler H, et al. (2003) Functional differentiation and selective inactivation of multiple Saccharomyces cerevisiae genes involved in very-long-chain fatty acid synthesis. Mol Genet Genomics 269(2):290-8
       TAS : Traceable Author Statement
IMP : Inferred from Mutant Phenotype
Assigned on 2003-07-08 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
fatty acid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0275
Assigned on 2007-05-23 UniProtKB
fatty acid elongation Oh CS, et al. (1997) ELO2 and ELO3, homologues of the Saccharomyces cerevisiae ELO1 gene, function in fatty acid elongation and are required for sphingolipid formation. J Biol Chem 272(28):17376-84
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-23 SGD
lipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0444
Assigned on 2007-05-23 UniProtKB
peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
sphingolipid biosynthetic process Oh CS, et al. (1997) ELO2 and ELO3, homologues of the Saccharomyces cerevisiae ELO1 gene, function in fatty acid elongation and are required for sphingolipid formation. J Biol Chem 272(28):17376-84
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-23 SGD
vesicle-mediated transport David D, et al. (1998) Involvement of long chain fatty acid elongation in the trafficking of secretory vesicles in yeast. J Cell Biol 143(5):1167-82
       IMP : Inferred from Mutant Phenotype
Assigned on 2001-01-18 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Han G, et al. (2002) The Saccharomyces cerevisiae YBR159w gene encodes the 3-ketoreductase of the microsomal fatty acid elongase. J Biol Chem 277(38):35440-9
       IDA : Inferred from Direct Assay
Assigned on 2002-11-20 SGD
endoplasmic reticulum membrane Choi JY and Martin CE (1999) The Saccharomyces cerevisiae FAT1 gene encodes an acyl-CoA synthetase that is required for maintenance of very long chain fatty acid levels. J Biol Chem 274(8):4671-83
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR002076
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
very long chain fatty acid biosynthesis

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forFEN1/YCR034W for FEN1
1) David D, et al. (1998) Involvement of long chain fatty acid elongation in the trafficking of secretory vesicles in yeast. J Cell Biol 143(5):1167-82

2) Oh CS, et al. (1997) ELO2 and ELO3, homologues of the Saccharomyces cerevisiae ELO1 gene, function in fatty acid elongation and are required for sphingolipid formation. J Biol Chem 272(28):17376-84

3) Abe M, et al. (2001) Yeast 1,3-beta-glucan synthase activity is inhibited by phytosphingosine localized to the endoplasmic reticulum. J Biol Chem 276(29):26923-30

4) Chung JH, et al. (2003) Sphingolipid requirement for generation of a functional v1 component of the vacuolar ATPase. J Biol Chem 278(31):28872-81

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for FEN1/YCR034W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for FEN1/YCR034W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MNSLVTQ

C-term PQHRRKR

Length(aa) 347

MW(Da) 40,002

pI 10.35

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.243

Codon Adaptation Index 0.239

Frequency of Optimal Codons 0.549

Hydropathicity of Protein 0.359

Aromaticity Score 0.159

10 20 30 40 50 | | | | | MNSLVTQYAAPLFERYPQLHDYLPTLERPFFNISLWEHFDDVVTRVTNGR FVPSEFQFIAGELPLSTLPPVLYAITAYYVIIFGGRFLLSKSKPFKLNGL FQLHNLVLTSLSLTLLLLMVEQLVPIIVQHGLYFAICNIGAWTQPLVTLY YMNYIVKFIEFIDTFFLVLKHKKLTFLHTYHHGATALLCYTQLMGTTSIS WVPISLNLGVHVVMYWYYFLAARGIRVWWKEWVTRFQIIQFVLDIGFIYF AVYQKAVHLYFPILPHCGDCVGSTTATFAGCAIISSYLVLFISFYINVYK RKGTKTSRVVKRAHGGVAAKVNEYVNVDLKNVPTPSPSPKPQHRRKR*

Protein Structures from PDB: proteins of known structure with sequence similarity to FEN1/YCR034W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
FEN1 SGD (2007) Information without a citation in SGD

Nomenclature History Notes
Date Note
2004-11-18 In the literature, FEN1 is sometimes used to refer to flap endonuclease, which in S. cerevisiae is encoded by RAD27
Liu Y, et al. (2004) Saccharomyces cerevisiae flap endonuclease 1 uses flap equilibration to maintain triplet repeat stability. Mol Cell Biol 24(9):4049-64

Standard Name	Reference
FEN1	SGD (2007) Information without a citation in SGD

Date	Note
2004-11-18	In the literature, FEN1 is sometimes used to refer to flap endonuclease, which in S. cerevisiae is encoded by RAD27 *Liu Y, et al.* (2004)** Saccharomyces cerevisiae flap endonuclease 1 uses flap equilibration to maintain triplet repeat stability. Mol Cell Biol 24(9):4049-64

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YCR034W SGD Systematic Sequence

850400 NCBI: Gene ID

NP_009963.1 NCBI: RefSeq protein version ID

NP_009963.1 NCBI: RefSeq protein version ID

6319882 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YCR034W	SGD Systematic Sequence
850400	NCBI: Gene ID
NP_009963.1	NCBI: RefSeq protein version ID
NP_009963.1	NCBI: RefSeq protein version ID
6319882	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
66 curated references; 0 references not yet curated
Genetic Interactions
Mutants/Phenotypes
Hodg CA, et al. (2010) Integral membrane proteins Brr6 and Apq12 link assembly of the nuclear pore complex to lipid homeostasis in the endoplasmic reticulum. J Cell Sci 123(Pt 1):141-151
       |ACC1 |APQ12 |ARE1 |ARE2 |ARV1 |BRR6 |DGA1 |ELO1 |ERG2 |ERG3 |ERG4 |ERG5 |ERG6 |LRO1 |MORE
Transcription
Momose Y, et al. (2010) Comparative analysis of transcriptional responses to the cryoprotectants, dimethyl sulfoxide and trehalose, which confer tolerance to freeze-thaw stress in Saccharomyces cerevisiae. Cryobiology
       |ACC1 |ARG1 |ARG3 |ARG4 |ARG5,6 |ARG7 |ARG8 |ATH1 |CPA1 |CPA2 |CRC1 |CYB2 |DAK1 |DAK2 |MORE
Regulation of
Cavalieri D, et al. (2009) Filling gaps in PPAR-alpha signaling through comparative nutrigenomics analysis. BMC Genomics 10():596
             |AAT2 |ADP1 |ARG4 |CAT2 |CDC60 |CRC1 |CYS3 |EHD3 |FOX2 |GLN1 |OAF1 |PIP2 |POT1 |SPS19 |MORE
Reviews
Ding J, et al. (2009) Tolerance and stress response to ethanol in the yeast Saccharomyces cerevisiae. Appl Microbiol Biotechnol 85(2):253-63
       |ADA2 |ASR1 |ATP1 |BEM2 |CHD1 |CTT1 |DDR2 |ERG6 |ERO1 |GCN5 |GIM4 |GIM5 |HFI1 |HMI1 |MORE
Regulation of
Lee CH, et al. (2009) Involvement of Vts1, a structure-specific RNA-binding protein, in Okazaki fragment processing in yeast. Nucleic Acids Res
       |DNA2 |VTS1
RNA Levels and Processing
Pedroso N, et al. (2009) Modulation of plasma membrane lipid profile and microdomains by H(2)O(2) in Saccharomyces cerevisiae. Free Radic Biol Med 46(2):289-98
       |ACC1 |ELO1 |ERG1 |ERG25 |ERG3 |ERG6 |ERG7 |FAS1 |GPT2 |LAC1 |LIP1 |OLE1 |RAD27 |SUR4
Cross-species Expression
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Quist TM, et al. (2009) HOS3, an ELO-Like Gene, Inhibits Effects of ABA and Implicates a S-1-P/Ceramide Control System for Abiotic Stress Responses in Arabidopsis thaliana. Mol Plant 2(1):138-151
     |SUR4
Evolution
Fungal Related Genes/Proteins
Protein Sequence Features
Turunen O, et al. (2009) In silico evidence for functional specialization after genome duplication in yeast. FEMS Yeast Res 9(1):16-31
       |ACC1 |ADH1 |ADH5 |CDC19 |CET1 |CTL1 |ELO1 |ERV14 |ERV15 |GCS1 |GRS1 |GRS2 |HFA1 |MCK1 |MORE
Computational analysis
Yosef N, et al. (2009) Toward accurate reconstruction of functional protein networks. Mol Syst Biol 5:248
       |BUD32 |EST1 |EST2 |EST3 |PRE2 |PRE8 |RAD27 |RGR1 |RNH201 |RNH202 |RPN12 |RPN6 |RPT3 |SCL1 |MORE
Transcription
Yu L, et al. (2009) Microarray analysis of p-anisaldehyde-induced transcriptome of Saccharomyces cerevisiae. J Ind Microbiol Biotechnol
       |AAD10 |AAD14 |AAD16 |AAD4 |AAD6 |ADE6 |ADH6 |CBF1 |CYS4 |LAG1 |MET1 |MET10 |MET13 |MET14 |MORE
Genetic Interactions
Addinall SG, et al. (2008) A Genomewide Suppressor and Enhancer Analysis of cdc13-1 Reveals Varied Cellular Processes Influencing Telomere Capping in Saccharomyces cerevisiae. Genetics 180(4):2251-66
       |APQ12 |ARC18 |ARV1 |ASC1 |ASE1 |BFA1 |BIM1 |BMH1 |BRE2 |BUB1 |BUB2 |BUB3 |BUD27 |CCS1 |MORE
Reviews
Dickson RC (2008) Thematic Review Series: Sphingolipids. New insights into sphingolipid metabolism and function in budding yeast. J Lipid Res 49(5):909-21
       |AUR1 |CSG2 |CSH1 |DPL1 |IFA38 |IPT1 |ISC1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |PHS1 |MORE
Genetic Interactions
Mutants/Phenotypes
Gustavsson M, et al. (2008) Functional genomics of monensin sensitivity in yeast: implications for post-Golgi traffic and vacuolar H(+)-ATPase function. Mol Genet Genomics 280(3):233-48
       |AKR1 |APL2 |ARC18 |ARF1 |BRE5 |BTS1 |CCZ1 |CDC50 |CHC1 |COG8 |EAF1 |EOS1 |ERG28 |FAB1 |MORE
Mutants/Phenotypes
Strains/Constructs
Ponnusamy S, et al. (2008) Regulation of Telomere Length by Fatty Acid Elongase 3 in Yeast: INVOLVEMENT OF INOSITOL PHOSPHATE METABOLISM AND Ku70/80 FUNCTION. J Biol Chem 283(41):27514-24
       |ARG82 |ELO1 |EST1 |IPK1 |ISC1 |KCS1 |LAG1 |RAD50 |SUR4 |TEL1 |YKU70 |YKU80
Alias
Fungal Related Genes/Proteins
Sakuradani E, et al. (2008) Functional analysis of a fatty acid elongase from arachidonic acid-producing Mortierella alpina 1S-4. Appl Microbiol Biotechnol 81(3):497-503
       |ELO1 |SUR4
Function/Process
Soong TT, et al. (2008) Physical protein-protein interactions predicted from microarrays. Bioinformatics 24(22):2608-14
       |CTK3 |ERV25 |GCS1 |MEX67 |NPL3 |POB3 |PUB1 |SEC27 |SUR4 |VAC8 |YPT1
Computational analysis
RNA Levels and Processing
Alvarez-Vasquez F, et al. (2007) Coordination of the dynamics of yeast sphingolipid metabolism during the diauxic shift. Theor Biol Med Model 4:42
       |AUR1 |DPP1 |ELO1 |FAS1 |FAS2 |GPT2 |IPT1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB4 |LCB5 |LIP1 |MORE
Reviews
Burhans WC and Weinberger M (2007) DNA replication stress, genome instability and aging. Nucleic Acids Res 35(22):7545-56
       |BCY1 |CLN3 |DNA2 |FOB1 |MEC1 |RAD53 |RAS1 |RAS2 |RIM15 |SCH9 |SGS1 |SNF1 |SOD2 |TOR1 |MORE
Reviews
Cowart LA and Obeid LM (2007) Yeast sphingolipids: recent developments in understanding biosynthesis, regulation, and function. Biochim Biophys Acta 1771(3):421-31
       |AUR1 |CSG2 |CSH1 |DPL1 |ISC1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |SUR1 |SUR4 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Daquinag A, et al. (2007) The yeast PH domain proteins Slm1 and Slm2 are targets of sphingolipid signaling during the response to heat stress. Mol Cell Biol 27(2):633-50
             |CNA1 |CSG2 |LCB4 |PKH1 |PKH2 |SLM1 |SLM2
Genetic Interactions
Large-scale genetic interaction
Mutants/Phenotypes
Strains/Constructs
Jain S, et al. (2007) Identification of a Novel Lysophospholipid Acyltransferase in Saccharomyces cerevisiae. J Biol Chem 282(42):30562-9
       |ALE1 |PMT5 |SLC1
Mutants/Phenotypes
Strains/Constructs
Lockshon D, et al. (2007) The sensitivity of yeast mutants to oleic Acid implicates the peroxisome and other processes in membrane function. Genetics 175(1):77-91
       |ADO1 |ADR1 |AIM38 |AKR1 |ARP6 |ATG17 |AVL9 |BUD14 |BUD22 |BUD23 |BUD31 |CAR2 |CBS1 |CLA4 |MORE
Alias
Cross-species Expression
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Prasitchoke P, et al. (2007) Functional analysis of very long-chain fatty acid elongase gene, HpELO2, in the methylotrophic yeast Hansenula polymorpha. Appl Microbiol Biotechnol 76(2):417-27
       |SUR4
Fungal Related Genes/Proteins
Prasitchoke P, et al. (2007) Identification and characterization of a very long-chain fatty acid elongase gene in the methylotrophic yeast, Hansenula polymorpha. Gene 391(1-2):16-25
         |ELO1 |SUR4
Cross-species Expression
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Qin YM, et al. (2007) Genetic and biochemical studies in yeast reveal that the cotton fibre-specific GhCER6 gene functions in fatty acid elongation. J Exp Bot 58(3):473-81
       |SUR4
Regulation of
Transcription
Rautio JJ, et al. (2007) Monitoring yeast physiology during very high gravity wort fermentations by frequent analysis of gene expression. Yeast 24(9):741-60
       |AAD6 |ADH1 |ADH2 |ADH3 |ADH4 |ALD6 |ARG1 |ASH1 |ATF1 |ATF2 |BAT1 |BAT2 |CCP1 |CLN2 |MORE
Reviews
Tehlivets O, et al. (2007) Fatty acid synthesis and elongation in yeast. Biochim Biophys Acta 1771(3):255-70
       |ACC1 |ACP1 |BPL1 |CEM1 |ELO1 |ETR1 |FAS1 |FAS2 |HFA1 |HTD2 |IFA38 |MCT1 |OAR1 |PPT2 |MORE
Protein Physical Properties
White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36
         |ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |MORE
Reviews
Dickson RC, et al. (2006) Functions and metabolism of sphingolipids in Saccharomyces cerevisiae. Prog Lipid Res 45(6):447-65
       |ARV1 |AUR1 |CSH1 |DPL1 |IPT1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |NCR1 |PKH1 |PKH2 |SCS7 |MORE
Cross-species Expression
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Paul S, et al. (2006) Members of the Arabidopsis FAE1-like 3-ketoacyl-CoA synthase gene family substitute for the Elop proteins of Saccharomyces cerevisiae. J Biol Chem 281(14):9018-29
       |SUR4
Genetic Interactions
Tabuchi M, et al. (2006) The phosphatidylinositol 4,5-biphosphate and TORC2 binding proteins Slm1 and Slm2 function in sphingolipid regulation. Mol Cell Biol 26(15):5861-75
             |AUR1 |BCK1 |CMP2 |CNB1 |CSG2 |GAS1 |GIM3 |INO2 |INO4 |ISC1 |KRE1 |LDB16 |MSS4 |NUP133 |MORE
Mutants/Phenotypes
van Voorst F, et al. (2006) Genome-wide identification of genes required for growth of Saccharomyces cerevisiae under ethanol stress. Yeast 23(5):351-9
       |ASR1 |ATP1 |BEM2 |ERG6 |FAB1 |GCN5 |GIM4 |GIM5 |HMI1 |IMG1 |KAR3 |MSK1 |MSN2 |MTF2 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22
       |ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |CSG2 |DPL1 |ELO1 |ERG24 |ERG3 |ERG4 |ERG5 |HEM1 |IFA38 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Zaremberg V, et al. (2005) Cytotoxicity of an anti-cancer lysophospholipid through selective modification of lipid raft composition. J Biol Chem 280(45):38047-58
       |ERG3 |LCB1 |PCT1 |PMA1 |SCS7 |SUR4
Cross-species Expression
Mietkiewska E, et al. (2004) Seed-specific heterologous expression of a nasturtium FAE gene in Arabidopsis results in a dramatic increase in the proportion of erucic acid. Plant Physiol 136(1):2665-75
           |SUR4
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Alias
Function/Process
Genetic Interactions
Mutants/Phenotypes
Valachovic M, et al. (2004) A mutation in sphingolipid synthesis suppresses defects in yeast ergosterol metabolism. Lipids 39(8):747-52
     |ECM22 |ERG2 |SUR4 |UPC2
Function/Process
Mutants/Phenotypes
Strains/Constructs
Chung JH, et al. (2003) Sphingolipid requirement for generation of a functional v1 component of the vacuolar ATPase. J Biol Chem 278(31):28872-81
       |CUP5 |PPA1 |SUR4 |TFP1 |TFP3 |VMA10 |VMA2 |VMA5 |VMA6 |VMA7 |VPH1
Function/Process
Mutants/Phenotypes
Enyenihi AH and Saunders WS (2003) Large-scale functional genomic analysis of sporulation and meiosis in Saccharomyces cerevisiae. Genetics 163(1):47-54
           |ADA2 |ADY2 |AKR1 |APS3 |APT1 |ARC1 |ARG82 |ARO2 |ATF1 |ATG11 |ATG15 |ATG16 |ATG5 |BPH1 |MORE
Alias
Mutants/Phenotypes
Strains/Constructs
Ran H, et al. (2003) Human targets of Pseudomonas aeruginosa pyocyanin. Proc Natl Acad Sci U S A 100(24):14315-20
           |BNA2 |BSD2 |BUD30 |CAT5 |CCM1 |CDC50 |CLN2 |COQ1 |DOA4 |ERG24 |FIG2 |GAS1 |GET2 |MRPL17 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Rossler H, et al. (2003) Functional differentiation and selective inactivation of multiple Saccharomyces cerevisiae genes involved in very-long-chain fatty acid synthesis. Mol Genet Genomics 269(2):290-8
       |ELO1 |IFA38 |SUR4
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Balguerie A, et al. (2002) Rvs161p and sphingolipids are required for actin repolarization following salt stress. Eukaryot Cell 1(6):1021-31
       |ACT1 |IPT1 |RVS161 |SLG1 |SUR1 |SUR2 |SUR4
Alias
Reviews
Funato K, et al. (2002) Biosynthesis and trafficking of sphingolipids in the yeast Saccharomyces cerevisiae. Biochemistry 41(51):15105-14
     |ACB1 |AUR1 |CCC2 |CSG2 |DPL1 |ELO1 |FMP45 |IFA38 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |LCB2 |MORE
Reviews
Obeid LM, et al. (2002) Yeast sphingolipids: metabolism and biology. Biochim Biophys Acta 1585(2-3):163-71
         |CSG2 |LCB4 |LCB5 |SUR1 |SUR2 |SUR4
Function/Process
Mutants/Phenotypes
Protein Processing/Modification/Regulation
Regulation of
Strains/Constructs
Abe M, et al. (2001) Yeast 1,3-beta-glucan synthase activity is inhibited by phytosphingosine localized to the endoplasmic reticulum. J Biol Chem 276(29):26923-30
       |SUR2
Alias
Function/Process
Baudry K, et al. (2001) The effect of the erg26-1 mutation on the regulation of lipid metabolism in Saccharomyces cerevisiae. J Biol Chem 276(16):12702-11
       |ERG25 |ERG26 |ERG27 |SUR4
Cell Growth and Metabolism
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Chung N, et al. (2001) Phytosphingosine as a specific inhibitor of growth and nutrient import in Saccharomyces cerevisiae. J Biol Chem 276(38):35614-21
         |DPL1 |HIS4 |LCB4 |LCB5 |LEU2 |SUR2 |TRP1
Alias
Genetic Interactions
Protein-protein Interactions
Kohlwein SD, et al. (2001) Tsc13p is required for fatty acid elongation and localizes to a novel structure at the nuclear-vacuolar interface in Saccharomyces cerevisiae. Mol Cell Biol 21(1):109-25
       |CSG2 |SUR4 |TSC13
Alias
Computational analysis
Radivoyevitch T (2001) Sphingoid base metabolism in yeast: mapping gene expression patterns into qualitative metabolite time course predictions. Comp Funct Genomics 2(5):289-94
             |AUR1 |DPL1 |FAS1 |FAS2 |LCB1 |LCB2 |LCB4 |LCB5 |SUR4
Other Features
Techniques and Reagents
Chung N and Obeid LM (2000) Use of yeast as a model system for studies of sphingolipid metabolism and signaling. Methods Enzymol 311():319-31
     |LCB4 |LCB5 |SUR2 |SUR4
Alias
Non-Fungal Related Genes/Proteins
Leonard AE, et al. (2000) Cloning of a human cDNA encoding a novel enzyme involved in the elongation of long-chain polyunsaturated fatty acids. Biochem J 350 Pt 3():765-70

Alias
Mutants/Phenotypes
Strains/Constructs
Stock SD, et al. (2000) Syringomycin E inhibition of Saccharomyces cerevisiae: requirement for biosynthesis of sphingolipids with very-long-chain fatty acids and mannose- and phosphoinositol-containing head groups. Antimicrob Agents Chemother 44(5):1174-80
       |CSG2 |IPT1 |SEC14 |SUR1 |SUR4
Genetic Interactions
Choi JY and Martin CE (1999) The Saccharomyces cerevisiae FAT1 gene encodes an acyl-CoA synthetase that is required for maintenance of very long chain fatty acid levels. J Biol Chem 274(8):4671-83
       |FAA1 |FAA2 |FAA4 |FAS2 |FAT1
Alias
Cell Cycle Phase Involved
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
RNA Levels and Processing
Reviews
Strains/Constructs
Substrates/Ligands/Cofactors
Dickson RC and Lester RL (1999) Metabolism and selected functions of sphingolipids in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1438(3):305-21
       |AUR1 |CSG2 |DPL1 |ERG2 |FAS2 |IPT1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |MSN2 |MSN4 |MSS4 |MORE
Reviews
Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510
       |ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Alias
Function/Process
Mutants/Phenotypes
Strains/Constructs
David D, et al. (1998) Involvement of long chain fatty acid elongation in the trafficking of secretory vesicles in yeast. J Cell Biol 143(5):1167-82
       |SEC6 |SNC1 |SNC2 |SUR4
Alias
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Oh CS, et al. (1997) ELO2 and ELO3, homologues of the Saccharomyces cerevisiae ELO1 gene, function in fatty acid elongation and are required for sphingolipid formation. J Biol Chem 272(28):17376-84
       |ELO1 |SUR4
Mutants/Phenotypes
Strains/Constructs
Rieger KJ, et al. (1997) Large-scale phenotypic analysis--the pilot project on yeast chromosome III. Yeast 13(16):1547-62
       |BPH1 |BUD23 |CSM1 |CTR86 |CWH43 |IMG1 |IMG2 |KRR1 |MRPL32 |NFS1 |PBN1 |RRP7 |RSA4 |SAT4 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Silve S, et al. (1996) The immunosuppressant SR 31747 blocks cell proliferation by inhibiting a steroid isomerase in Saccharomyces cerevisiae. Mol Cell Biol 16(6):2719-27
       |ERG2 |SUR4
Reviews
Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6
     |ERG1 |ERG11 |ERG2 |ERG24 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9 |FEN2
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Revardel E, et al. (1995) Characterization of a new gene family developing pleiotropic phenotypes upon mutation in Saccharomyces cerevisiae. Biochim Biophys Acta 1263(3):261-5
     |RVS161 |RVS167 |SUR4
Cellular Location
Function/Process
Mapping
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
el-Sherbeini M and Clemas JA (1995) Cloning and characterization of GNS1: a Saccharomyces cerevisiae gene involved in synthesis of 1,3-beta-glucan in vitro. J Bacteriol 177(11):3227-34

Mapping
Mutants/Phenotypes
Strains/Constructs
Ladeveze V, et al. (1993) General resistance to sterol biosynthesis inhibitors in Saccharomyces cerevisiae. Lipids 28(10):907-12
     |IDI1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Lorenz RT and Parks LW (1992) Cloning, sequencing, and disruption of the gene encoding sterol C-14 reductase in Saccharomyces cerevisiae. DNA Cell Biol 11(9):685-92
     |ERG24 |FEN2
DNA/RNA Sequence Features
Wicksteed BL, et al. (1991) The complete sequence of a 7.5 kb region of chromosome III from Saccharomyces cerevisiae that lies between CRY1 and MAT. Yeast 7(7):761-72
     |RPS14A |SNT1
Mapping
Thierry A, et al. (1990) The complete sequence of the 8.2 kb segment left of MAT on chromosome III reveals five ORFs, including a gene for a yeast ribokinase. Yeast 6(6):521-34
     |MATALPHA |RBK1 |RRP43

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.