---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

BUD3/YCL014W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIII: 96281 to 101191 CDS: 96281 - 101191 Genetic position: -9 cM Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
BUD3	YCL014W	YCL012W	ORF, Verified	S000000520
Description
Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By Rho guanyl-nucleotide exchange factor activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000219 Assigned on 2007-05-23 UniProtKB molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2001-01-19 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By axial cellular bud site selection Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0131 Assigned on 2007-05-23 UniProtKB cell division Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular bud site selection Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-03-02 SGD cytokinesis Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-01-19 SGD Bailly E, et al. (2003) Differential cellular localization among mitotic cyclins from Saccharomyces cerevisiae: a new role for the axial budding protein Bud3 in targeting Clb2 to the mother-bud neck. J Cell Sci 116(Pt 20):4119-30      IMP : Inferred from Mutant Phenotype Assigned on 2005-06-02 SGD regulation of Rho protein signal transduction DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000219 Assigned on 2007-05-23 UniProtKB reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cellular bud neck Bailly E, et al. (2003) Differential cellular localization among mitotic cyclins from Saccharomyces cerevisiae: a new role for the axial budding protein Bud3 in targeting Clb2 to the mother-bud neck. J Cell Sci 116(Pt 20):4119-30      IDA : Inferred from Direct Assay Assigned on 2005-06-02 SGD cellular bud neck contractile ring Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD intracellular DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000219 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forBUD3/YCL014W for BUD3 1) Chant J and Herskowitz I (1991) Genetic control of bud site selection in yeast by a set of gene products that constitute a morphogenetic pathway. Cell 65(7):1203-12        2) Chant J, et al. (1995) Role of Bud3p in producing the axial budding pattern of yeast. J Cell Biol 129(3):767-78

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BUD3/YCL014W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BUD3/YCL014W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MEKDLSS C-term PEKLKFY Length(aa) 1,636 MW(Da) 184,717 pI 6.07 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.026   Codon Adaptation Index 0.141   Frequency of Optimal Codons 0.433   Hydropathicity of Protein -0.651   Aromaticity Score 0.078

10 20 30 40 50 | | | | | MEKDLSSLYSEKKDKENDETLFNIKLSKSVVETTPLNGHSLFDDDKSLSD WTDNVFTQSVFYHGSDDLIWGKFFVCVYKSPNSNKLNAIIFDKLGTSCFE SVDISSNSQYYPAIENLSPSDQESNVKKCIAVILLQRYPLLSPSDLSQIL SNKSENCDYDPPYAGDLASSCQLITAVPPEDLGKRFFTSGLLQNRFVSST LLDVIYENNESTIELNNRLVFHLGEQLEQLFNPVTEYSPEQTEYGYKAPE DELPTESDDDLVKAICNELLQLQTNFTFNLVEFLQKFLIALRVRVLNEEI NGLSTTKLNRLFPPTIDEVTRINCIFLDSLKTAIPYGSLEVLKACSITIP YFYKAYTRHEAATKNFSKDIKLFIRHFSNVIPEREVYTEMKIESIIKGPQ EKLLKLKLIIERLWKSKKWRPKNQEMAKKCYNNIIDVIDSFGKLDSPLHS YSTRVFTPSGKILTELAKCWPVELQYKWLKRRVVGVYDVVDLNDENKRNL LVIFSDYVVFINILEAESYYTSDGSNRPLISDILMNSLINEVPLPSKIPK LKVERHCYIDEVLVSILDKSTLRFDRLKGKDSFSMVCKLSSAFISSSSVA DLITKARILEKDTAFHLFKASRSHFTLYSTAHELCAYDSEKIKSKFALFL NIPPSKEILEVNNLHLAFFARFCSNDGRDNIVILDVLTKHDDKHIEVTSD NIVFTIINQLAIEIPICFSSLNSSMAKDLLCVNENLIKNLEHQLEEVKHP STDEHRAVNSKLSGASDFDATHEKKRSYGTITTFRSYTSDLKDSPSGDNS NVTKETKEILPVKPTKKSSKKPREIQKKTKTNASKAEHIEKKKPNKGKGF FGVLKNVFGSKSKSKPSPVQRVPKKISQRHPKSPVKKPMTSEKKSSPKRA VVSSPKIKKKSTSFSTKESQTAKSSLRAVEFKSDDLIGKPPDVGNGAHPQ ENTRISSVVRDTKYVSYNPSQPVTENTSNEKNVEPKADQSTKQDNISNFA DVEVSASSYPEKLDAETDDQIIGKATNSSSVHGNKELPDLAEVTTANRVS TTSAGDQRIDTQSEFLRAADVENLSDDDEHRQNESRVFNDDLFGDFIPKH YRNKQENINSSSNLFPEGKVPQEKGVSNENTNISLKTNEDASTLTQKLSP QASKVLTENSNELKDTNNEGKDAKDIKLGDDYSDKETAKEITKPKNFVEG ITERKEIFPTIPRLAPPASKINFQRSPSYIELFQGMRVVLDKHDAHYNWK RLASQVSLSEGLKVNTEEDAAIINKSQDDAKAERMTQISEVIEYEMQQPI PTYLPKAHLDDSGIEKSDDKFFEIEEELKEELKGSKTGNEDVGNNNPSNS IPKIEKPPAFKVIRTSPVRIIGRTFEDTRKYENGSPSDISFTYDTHNNDE PDKRLMELKFPSQDEIPDDRFYTPAEEPTAEFPVEELPNTPRSINVTTSN NKSTDDKLSSGNIDQKPTELLDDLEFSSFNIAFGNTSMSTDNMKISSDLS SNKTVLGNAQKVQESPSGPLIYVLPQSSTKHEKEGFLRKKQKDEPIWVSP SKIDFADLSRRTKALTPERNTVPLKNNDSRKYKYTGEGSIGNMTNMLLTK DASYAYLKDFVALSDDEDEDGKQNCAVGGPEKLKFY*

Protein Structures from PDB: proteins of known structure with sequence similarity to BUD3/YCL014W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
BUD3	Chant J and Herskowitz I (1991) Genetic control of bud site selection in yeast by a set of gene products that constitute a morphogenetic pathway. Cell 65(7):1203-12

Sequence Annotation Notes

Date	Note
1998-02-26	Four separate single nucleotide sequence changes were made in the systematic sequence in the region encompassing ORF YCL014W. A single A was deleted at chromosomal coordinate 98839, as was the G at 100475, and a single G was inserted after the A at 100471, and also after the G at 100535. Note that while the coordinates may appear to be different, these changes are the exact reciprocals of those made on 1997-07-27, returning the systematic sequence to its original state in this region. Old: 98810 GTGACAGAAAATACCAGTAACGAAAAAAAATGTCGAACCAAAAGCGGATCAATCCACAAA 98869 ||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||| New: 98814 GTGACAGAAAATACCAGTAACGAAAAAAA-TGTCGAACCAAAAGCGGATCAATCCACAAA 98872 Old: 100430 TCAAGAGTCTCCTAGTGGACCATTAATCTATGTTTTGCCTCA-AGTGAGCACAAAGCATG 100488 |||||||||||||||||||||||||||||||||||||||||| ||| ||||||||||||| New: 100433 TCAAGAGTCTCCTAGTGGACCATTAATCTATGTTTTGCCTCAGAGT-AGCACAAAGCATG 100491 Old: 100489 AGAAAGAGGGGTTCCTTCGAAAGAAACAAAAAGACGAGCCCATTTGG-TTTCCCCTAGCA 100547 ||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| New: 100492 AGAAAGAGGGGTTCCTTCGAAAGAAACAAAAAGACGAGCCCATTTGGGTTTCCCCTAGCA 100551
2000-09-13	Several sequence changes were made in the systematic sequence in the region encompassing feature YCL014W, resulting in the merge of ORF YCL012W into YCL014W. Note that coordinates listed are chromosomal coordinates. Old: 96731 CAATTTGGTAGAATTTTTGCCAAAATTCCTGATCGCCTTGAGAGTCAGAGTACTCAATGA 96790 |||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| New: 97113 CAATTTGGTAGAATTTTTGCAAAAATTCCTGATCGCCTTGAGAGTCAGAGTACTCAATGA 97172 Old: 97091 ACCTCAGGAAAAACTACTGAAGCTAAACTTAATTATAGAGAGATTGTGGAAGTCGAAAAA 97150 ||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||| New: 97473 ACCTCAGGAAAAACTACTGAAGCTAAAGTTAATTATAGAGAGATTGTGGAAGTCGAAAAA 97532 Old: 99851 TGACAAATTCTTCGAAATTGAAGAAGAACTTAAGGAAGAATTGAAGGGCAGCAAAAC-GG 99909 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || New: 100233 TGACAAATTCTTCGAAATTGAAGAAGAACTTAAGGAAGAATTGAAGGGCAGCAAAACCGG 100292 Old: 99970 AGCATTCAAAGTTATTAGAACATCGCCTGTGAGAATTATCGGAAGGCACTTTTGAAGACA 100029 |||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| New: 100353 AGCATTCAAAGTTATTAGAACATCGCCTGTGAGAATTATCGGAAGG-ACTTTTGAAGACA 100411
1997-07-27	Two single nucleotide deletions and two single nucleotide insertions were made within the ORF YCL014W to correct the systematic reference sequence: The G at chromosomal coordinate 100475 was removed, as was the G at 100539, a single A was inserted after chromosomal coordinate 98842, and a single G was inserted after chromosomal coordinate 100478. New: 98814 GTGACAGAAAATACCAGTAACGAAAAAAAATGTCGAACCAAAAGCGGATCAATCCACAAA 98873 ||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||| Old: 98814 GTGACAGAAAATACCAGTAACGAAAAAAA-TGTCGAACCAAAAGCGGATCAATCCACAAA 98872 New: 100434 TCAAGAGTCTCCTAGTGGACCATTAATCTATGTTTTGCCTCA-AGTGAGCACAAAGCATG 100492 |||||||||||||||||||||||||||||||||||||||||| ||| ||||||||||||| Old: 100433 TCAAGAGTCTCCTAGTGGACCATTAATCTATGTTTTGCCTCAGAGT-AGCACAAAGCATG 100491 New: 100493 AGAAAGAGGGGTTCCTTCGAAAGAAACAAAAAGACGAGCCCATTTGG-TTTCCCCTAGCA 100551 ||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| Old: 100492 AGAAAGAGGGGTTCCTTCGAAAGAAACAAAAAGACGAGCCCATTTGGGTTTCCCCTAGCA 100551

Mapping Notes

Date	Note
1992-10-01	Edition 11: bud3 is 4 cM from leu2; there were two recombinants among 50 meiotic segregants Mortimer RK, et al. (1992) Genetic and physical maps of Saccharomyces cerevisiae, Edition 11. Yeast 8(10):817-902

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YCL014W	SGD Systematic Sequence
850345	NCBI: Gene ID
NP_009914.2	NCBI: RefSeq protein version ID
NP_009914.2	NCBI: RefSeq protein version ID
10383775	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
38 curated references; 0 references not yet curated
Fungal Related Genes/Proteins	Kaufmann A and Philippsen P (2009) Of bars and rings: Hof1-dependent cytokinesis in multiseptated hyphae of Ashbya gossypii. Mol Cell Biol 29(3):771-83	|HOF1 |IQG1 |MYO1
Reviews	Slaughter BD, et al. (2009) Symmetry breaking in the life cycle of the budding yeast. Cold Spring Harbor Perspect Biol 1(3):a003384	|AXL1 |AXL2 |BEM1 |BNI1 |BNR1 |BUD2 |BUD4 |BUD5 |BUD8 |BUD9 |CDC24 |CDC42 |FAR1 |RAX1 |MORE
Cellular Location	Zou J, et al. (2009) Regulation of cell polarity through phosphorylation of Bni4 by Pho85 G1 cyclin-dependent kinases in Saccharomyces cerevisiae. Mol Biol Cell 20(14):3239-50	|AIM44 |APL3 |AXL1 |BCK1 |BEM1 |BEM2 |BNI1 |BNI4 |BNR1 |BOI1 |BOP3 |BUD22 |BUD4 |CDC10 |MORE
Protein Sequence Features	Chang EJ, et al. (2007) Prediction of cyclin-dependent kinase phosphorylation substrates. PLoS One 2(7):e656	|ACC1 |ACE2 |ACM1 |ADY3 |AFI1 |ALY2 |ASE1 |ASH1 |BCK1 |BEM3 |BNI1 |BNI4 |BOI1 |BUD4 |MORE
Cell Cycle Phase Involved Protein-protein Interactions	Gao XD, et al. (2007) Sequential and distinct roles of the cadherin domain-containing protein Axl2p in cell polarization in yeast cell cycle. Mol Biol Cell 18(7):2542-60	|AXL2 |BEM1 |BUD4 |CDC24 |CDC42 |CLA4 |GIC2 |GIN4 |RSR1 |SWE1
Function/Process Genetic Interactions Strains/Constructs	Hood-Degrenier JK, et al. (2007) Cytoplasmic Clb2 is required for timely inactivation of the mitotic inhibitor Swe1 and normal bud morphogenesis in Saccharomyces cerevisiae. Curr Genet 51(1):1-18	|CDC28 |CLB1 |CLB2 |CLB3 |CLB4 |SWE1
Function/Process Mutants/Phenotypes Strains/Constructs	Loewen CJ, et al. (2007) Inheritance of cortical ER in yeast is required for normal septin organization. J Cell Biol 179(3):467-83	|AXL2 |BEM2 |BEM3 |BIM1 |BNI1 |BUD6 |CDC10 |CLA4 |HSL7 |ICE2 |MIH1 |MSB3 |MSB4 |MYO4 |MORE
Reviews	Park HO and Bi E (2007) Central roles of small GTPases in the development of cell polarity in yeast and beyond. Microbiol Mol Biol Rev 71(1):48-96	|ACT1 |AXL1 |AXL2 |BEM1 |BEM2 |BEM3 |BNI1 |BUD2 |BUD4 |BUD5 |BUD8 |BUD9 |CDC10 |CDC11 |MORE
Genetic Interactions Strains/Constructs	Tong Z, et al. (2007) Adjacent positioning of cellular structures enabled by a Cdc42 GTPase-activating protein-mediated zone of inhibition. J Cell Biol 179(7):1375-84	|BEM2 |CDC24 |CDC42 |RGA1 |RGA2 |RSR1
Cellular Location	Caesar R, et al. (2006) Physiological importance and identification of novel targets for the N-terminal acetyltransferase NatB. Eukaryot Cell 5(2):368-78	|ACT1 |ARP1 |CAC2 |CSM1 |DST1 |GIS1 |IOC3 |KAR3 |KAR9 |MDM20 |MLC2 |NAT3 |NNF2 |PAC10 |MORE
Protein-protein Interactions	Smolka MB, et al. (2006) An FHA domain-mediated protein interaction network of Rad53 reveals its role in polarized cell growth. J Cell Biol 175(5):743-53	|ASF1 |BUD14 |BUD4 |CDC10 |CDC11 |CDC12 |CDC3 |CRP1 |CST6 |ECM16 |ESC1 |FYV8 |GLN3 |IFH1 |MORE
DNA/RNA Sequence Features Nucleic Acid Interaction Regulation of Transcription	Ansari A and Hampsey M (2005) A role for the CPF 3'-end processing machinery in RNAP II-dependent gene looping. Genes Dev 19(24):2969-78	|PTA1 |RPO21 |RPT6 |SEN1 |SSU72
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gladfelter AS, et al. (2005) Interplay between septin organization, cell cycle and cell shape in yeast. J Cell Sci 118(Pt 8):1617-28	|BNI1 |BNI4 |BNR1 |BUD4 |BUD5 |CDC12 |CDC42 |CLN1 |CLN2 |SWE1
Protein Sequence Features Protein-protein Interactions	Archambault V, et al. (2004) Targeted proteomic study of the cyclin-Cdk module. Mol Cell 14(6):699-711	|ACE2 |ACM1 |BEM3 |BIK1 |BMH2 |CBK1 |CDC25 |CDC28 |CDC4 |CDC48 |CDC53 |CDC6 |CDH1 |CKS1 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Fujita A, et al. (2004) Rax1, a protein required for the establishment of the bipolar budding pattern in yeast. Gene 327(2):161-9	|AXL1 |AXL2 |BUD4 |BUD5 |BUD8 |BUD9 |RAX1
DNA/RNA Sequence Features Regulation of	Kreiman G (2004) Identification of sparsely distributed clusters of cis-regulatory elements in sets of co-expressed genes. Nucleic Acids Res 32(9):2889-900	|ACE2 |AIM20 |ALK1 |APC1 |BUD4 |BUD8 |CDC20 |CDC5 |CHS2 |CLB1 |CLB2 |HOF1 |HST3 |IQG1 |MORE
Cell Cycle Phase Involved Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Regulatory Role Strains/Constructs	Bailly E, et al. (2003) Differential cellular localization among mitotic cyclins from Saccharomyces cerevisiae: a new role for the axial budding protein Bud3 in targeting Clb2 to the mother-bud neck. J Cell Sci 116(Pt 20):4119-30	|CDC28 |CLB1 |CLB2 |CLB3 |CLB4
Fungal Related Genes/Proteins	Wendland J (2003) Analysis of the landmark protein Bud3 of Ashbya gossypii reveals a novel role in septum construction. EMBO Rep 4(2):200-4
Cellular Location Function/Process RNA Levels and Processing	Cullen PJ and Sprague GF Jr (2002) The roles of bud-site-selection proteins during haploid invasive growth in yeast. Mol Biol Cell 13(9):2990-3004	|AXL1 |AXL2 |BUD2 |BUD4 |BUD8 |SNF1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Lord M, et al. (2002) Subcellular localization of Axl1, the cell type-specific regulator of polarity. Curr Biol 12(15):1347-52	|AXL1 |AXL2 |BUD4 |BUD5
Function/Process Fungal Related Genes/Proteins Protein Processing/Modification/Regulation	Schmidt M, et al. (2002) In budding yeast, contraction of the actomyosin ring and formation of the primary septum at cytokinesis depend on each other. J Cell Sci 115(Pt 2):293-302	|BUD4 |CHS2 |CHS3 |MYO1 |SPA2
Function/Process Mutants/Phenotypes Strains/Constructs	Kang PJ, et al. (2001) A GDP/GTP exchange factor involved in linking a spatial landmark to cell polarity. Science 292(5520):1376-8	|AXL2 |BUD5 |BUD8 |BUD9 |RSR1
Genetic Interactions Mutants/Phenotypes	Freedman T, et al. (2000) Mutational and hyperexpression-induced disruption of bipolar budding in yeast. Microbiology 146 ( Pt 11)():2833-43	|ACT1 |ATC1 |AXL2 |MYO2 |PDE2 |PFY1 |RSR1 |SMY1
Cell Cycle Phase Involved Cellular Location Mutants/Phenotypes Protein Processing/Modification/Regulation Regulation of Strains/Constructs Transcription	Lord M, et al. (2000) Cell cycle programs of gene expression control morphogenetic protein localization. J Cell Biol 151(7):1501-12	|AXL2
Function/Process Mutants/Phenotypes Regulation of Strains/Constructs	Palecek SP, et al. (2000) Genetic analysis reveals that FLO11 upregulation and cell polarization independently regulate invasive growth in Saccharomyces cerevisiae. Genetics 156(3):1005-23	|ADH1 |ARO7 |AXL1 |AXL2 |BEM2 |BPL1 |BUD4 |CDC53 |CSE2 |DIA1 |DIA2 |DIA3 |DIA4 |ELM1 |MORE
Reviews	Pruyne D and Bretscher A (2000) Polarization of cell growth in yeast. J Cell Sci 113 ( Pt 4):571-85	|ABP1 |ACT1 |AIP1 |ARC15 |ARC18 |ARC19 |ARC35 |ARC40 |ARP2 |ARP3 |AXL2 |BEM1 |BNI1 |BNI4 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Thompson DA and Stahl FW (1999) Genetic control of recombination partner preference in yeast meiosis. Isolation and characterization of mutants elevated for meiotic unequal sister-chromatid recombination. Genetics 153(2):621-41	|DMC1 |ELA1 |INP52 |MEC1 |MEC3 |MEK1 |MSC1 |MSC2 |MSC3 |MSC6 |MSC7 |PET122 |RAD17 |RAD24 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Elia L and Marsh L (1998) A role for a protease in morphogenic responses during yeast cell fusion. J Cell Biol 142(6):1473-85	|AXL1 |BEM1 |CDC24 |CDC42 |FUS2 |RSR1
DNA/RNA Sequence Features Techniques and Reagents	Neuwald AF, et al. (1997) Extracting protein alignment models from the sequence database. Nucleic Acids Res 25(9):1665-77	|FUS2
Function/Process Regulatory Role	Halme A, et al. (1996) Bud10p directs axial cell polarization in budding yeast and resembles a transmembrane receptor. Curr Biol 6(5):570-9	|AXL2 |BUD4
Genetic Interactions	Roemer T, et al. (1996) Selection of axial growth sites in yeast requires Axl2p, a novel plasma membrane glycoprotein. Genes Dev 10(7):777-93	|AXL2 |CDC10 |SPA2
Fungal Related Genes/Proteins Mutants/Phenotypes	Sanders SL and Herskowitz I (1996) The BUD4 protein of yeast, required for axial budding, is localized to the mother/BUD neck in a cell cycle-dependent manner. J Cell Biol 134(2):413-27	|BUD4 |CDC12
Cell Cycle Phase Involved Cellular Location DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Chant J, et al. (1995) Role of Bud3p in producing the axial budding pattern of yeast. J Cell Biol 129(3):767-78	|CDC10 |CDC11 |CDC12 |CDC3
Cellular Location	Sanders SL and Field CM (1995) Cell division. Bud-site selection is only skin deep. Curr Biol 5(11):1213-5
Fungal Related Genes/Proteins	Park HO, et al. (1993) BUD2 encodes a GTPase-activating protein for Bud1/Rsr1 necessary for proper bud-site selection in yeast. Nature 365(6443):269-74	|BUD2 |BUD4 |BUD5 |CDC25 |RSR1
Function/Process	Wright RM, et al. (1993) Reversible pseudohyphal growth in haploid Saccharomyces cerevisiae is an aerobic process. Curr Genet 23(5-6):388-91	|BUD4
Mutants/Phenotypes Strains/Constructs	Chant J and Herskowitz I (1991) Genetic control of bud site selection in yeast by a set of gene products that constitute a morphogenetic pathway. Cell 65(7):1203-12	|BUD2 |BUD4 |RSR1
Reviews	Chant J and Pringle JR (1991) Budding and cell polarity in Saccharomyces cerevisiae. Curr Opin Genet Dev 1(3):342-50	|CDC24 |PFY1 |RSR1

Return to SGD

Send a Message to the SGD Curators