---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

BSD2/YBR290W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrII: 782587 to 783552 CDS: 782587 - 783552 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
BSD2	YBR290W		ORF, Verified	S000000494
Description
Heavy metal ion homeostasis protein, facilitates trafficking of Smf1p and Smf2p metal transporters to the vacuole where they are degraded, controls metal ion transport, prevents metal hyperaccumulation, functions in copper detoxification

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By protein binding Hettema EH, et al. (2004) Bsd2 binds the ubiquitin ligase Rsp5 and mediates the ubiquitination of transmembrane proteins. EMBO J 23(6):1279-88          IDA : Inferred from Direct Assay Assigned on 2005-07-15 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By metal ion transport Liu XF, et al. (1997) Negative control of heavy metal uptake by the Saccharomyces cerevisiae BSD2 gene. J Biol Chem 272(18):11763-9        IMP : Inferred from Mutant Phenotype Assigned on 2003-04-14 SGD protein targeting to vacuole Liu XF and Culotta VC (1999) Post-translation control of Nramp metal transport in yeast. Role of metal ions and the BSD2 gene. J Biol Chem 274(8):4863-8        IMP : Inferred from Mutant Phenotype Assigned on 2002-09-18 SGD Hettema EH, et al. (2004) Bsd2 binds the ubiquitin ligase Rsp5 and mediates the ubiquitination of transmembrane proteins. EMBO J 23(6):1279-88          IMP : Inferred from Mutant Phenotype Assigned on 2005-07-15 SGD response to stress GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0346 Assigned on 2009-03-04 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2009-03-04 UniProtKB ubiquitin-dependent protein catabolic process Stimpson HE, et al. (2006) Transferrin receptor-like proteins control the degradation of a yeast metal transporter. EMBO J 25(4):662-72        IMP : Inferred from Mutant Phenotype Assigned on 2007-02-05 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Liu XF, et al. (1997) Negative control of heavy metal uptake by the Saccharomyces cerevisiae BSD2 gene. J Biol Chem 272(18):11763-9        IDA : Inferred from Direct Assay Assigned on 2002-09-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2009-03-04 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0095 Assigned on 2009-03-04 UniProtKB fungal-type vacuole membrane Hettema EH, et al. (2004) Bsd2 binds the ubiquitin ligase Rsp5 and mediates the ubiquitination of transmembrane proteins. EMBO J 23(6):1279-88          IDA : Inferred from Direct Assay Assigned on 2005-07-15 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB vacuole GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0926 Assigned on 2009-03-04 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0272 Assigned on 2009-03-04 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forBSD2/YBR290W for BSD2 1) Liu XF, et al. (1997) Negative control of heavy metal uptake by the Saccharomyces cerevisiae BSD2 gene. J Biol Chem 272(18):11763-9        2) Liu XF and Culotta VC (1994) The requirement for yeast superoxide dismutase is bypassed through mutations in BSD2, a novel metal homeostasis gene. Mol Cell Biol 14(11):7037-45      3) Portnoy ME, et al. (2000) Saccharomyces cerevisiae expresses three functionally distinct homologues of the nramp family of metal transporters. Mol Cell Biol 20(21):7893-902        4) Lapinskas PJ, et al. (1995) Mutations in PMR1 suppress oxidative damage in yeast cells lacking superoxide dismutase. Mol Cell Biol 15(3):1382-8

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BSD2/YBR290W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BSD2/YBR290W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MPEQELL C-term NQSQNQA Length(aa) 321 MW(Da) 35,763 pI 4.52 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.047   Codon Adaptation Index 0.106   Frequency of Optimal Codons 0.388   Hydropathicity of Protein -0.547   Aromaticity Score 0.084	10 20 30 40 50 | | | | | MPEQELLIGQEMNTLHAGSSTDGINVGNAGRTRDTQTGVEGETEIGSDEE DSIEDEGSSSGGNSTTERLVPHQLREQAARHIGKIGRHFNILDRLFKKRT QQSSDIQQGAMFDGVFSNLSAKPDTTETEGNNEQDIPPTYDEAAADMAPS YYGMDLNNSDIYYDEICIEGLPVGNIANLLWNIIVSTSFQFIGFLITYIL HTSHAAKQGSRFGLGLTFIGYGYSMIPNDVTSKVGKNKSLNRMELEDPNE FDDVRLNSQSTTQDKFESHLNHGLDEEKQNIPWLAVFVAFLGLFITLKSI YDYIQVKKLEKKYLNQSQNQA*

Protein Structures from PDB: proteins of known structure with sequence similarity to BSD2/YBR290W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
BSD2	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YBR290W	SGD Systematic Sequence
852593	NCBI: Gene ID
NP_009849.1	NCBI: RefSeq protein version ID
NP_009849.1	NCBI: RefSeq protein version ID
6319767	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
36 curated references; 0 references not yet curated
Mutants/Phenotypes Strains/Constructs	Jensen LT, et al. (2009) Down-regulation of a manganese transporter in the face of metal toxicity. Mol Biol Cell 20(12):2810-9	|FUR4 |PMR1 |RSP5 |SMF1 |SMF2 |TAT2 |TRE1 |TRE2
Reviews	Leon S and Haguenauer-Tsapis R (2009) Ubiquitin ligase adaptors: regulators of ubiquitylation and endocytosis of plasma membrane proteins. Exp Cell Res 315(9):1574-83	|ALY1 |ALY2 |ART5 |BUL1 |BUL2 |CSR2 |EAR1 |ECM21 |LDB19 |RIM8 |ROD1 |ROG3 |RSP5 |SSH4 |MORE
Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs	Nikko E and Pelham HR (2009) Arrestin-mediated endocytosis of yeast plasma membrane transporters. Traffic 10(12):1856-67	|ALY1 |ALY2 |ART10 |ART5 |BUL1 |BUL2 |CSR2 |EAR1 |ECM21 |FUR4 |HXT6 |ITR1 |LDB19 |PIB1 |MORE
Reviews	Reddi AR, et al. (2009) Manganese homeostasis in Saccharomyces cerevisiae. Chem Rev 109(10):4722-32	|CCC1 |CSR2 |ECM21 |FET5 |FTH1 |PCA1 |PHO84 |PMR1 |RSP5 |SMF1 |SMF2 |SMF3 |SOD1 |TRE1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Reddi AR, et al. (2009) The overlapping roles of manganese and Cu/Zn SOD in oxidative stress protection. Free Radic Biol Med 46(2):154-62	|PHO80 |PHO84 |PMR1 |SMF1 |SMF2 |SOD1 |SOD2 |VPH1 |VTC4
Reviews	Rotin D and Kumar S (2009) Physiological functions of the HECT family of ubiquitin ligases. Nat Rev Mol Cell Biol 10(6):398-409	|ALY1 |ALY2 |ART5 |CSR2 |EAR1 |ECM21 |LDB19 |MUP1 |RIM8 |ROD1 |ROG3 |RSP5 |RUP1 |SMF1 |MORE
Reviews	Belgareh-Touze N, et al. (2008) Versatile role of the yeast ubiquitin ligase Rsp5p in intracellular trafficking. Biochem Soc Trans 36(Pt 5):791-6	|BUL1 |BUL2 |CPS1 |EAR1 |FUR4 |GAP1 |PPN1 |RSP5 |SIT1 |SMF1 |SNA3 |SSH4 |TAT2 |TRE1 |MORE
Mutants/Phenotypes Strains/Constructs	Bockhorn J, et al. (2008) Genome-wide screen of Saccharomyces cerevisiae null allele strains identifies genes involved in selenomethionine resistance. Proc Natl Acad Sci U S A 105(46):17682-17687	|AAH1 |APQ13 |ARC18 |ARE1 |ARO7 |ASI3 |BUD23 |CGR1 |CSG2 |CYS3 |DAL3 |GRE2 |HHT2 |HMG1 |MORE
Mutants/Phenotypes Strains/Constructs	Erpapazoglou Z, et al. (2008) Substrate- and ubiquitin-dependent trafficking of the yeast siderophore transporter Sit1. Traffic 9(8):1372-91	|BUL1 |BUL2 |DOA4 |END3 |GGA1 |GGA2 |PEP12 |PIB1 |RSP5 |SEC14 |SIT1 |TRE1 |TRE2 |TUL1 |MORE
RNA Levels and Processing Transcription	Jin YH, et al. (2008) Global transcriptome and deletome profiles of yeast exposed to transition metals. PLoS Genet 4(4):e1000053	|ADH1 |ARN1 |ARN2 |ATM1 |ATX1 |BCK1 |BNI1 |BUD16 |BUD25 |CCC2 |CKA1 |CKA2 |CKB2 |CLN3 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	McNatt MW, et al. (2007) Direct binding to Rsp5 mediates ubiquitin-independent sorting of Sna3 via the multivesicular body pathway. Mol Biol Cell 18(2):697-706	|RSP5 |SNA3 |TUL1
Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions Regulation of Regulatory Role Strains/Constructs Techniques and Reagents	Sullivan JA, et al. (2007) Multiple interactions drive adaptor-mediated recruitment of the ubiquitin ligase rsp5 to membrane proteins in vivo and in vitro. Mol Biol Cell 18(7):2429-40	|CPS1 |RSP5 |SMF1 |TRE1
Cross-species Expression Genetic Interactions Strains/Constructs	Techau ME, et al. (2007) Evolution of differences in transport function in Slc11a family members. J Biol Chem 282(49):35646-56	|RER1 |SMF1 |SMF2 |SMF3
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Watson H and Bonifacino JS (2007) Direct binding to Rsp5p regulates ubiquitination-independent vacuolar transport of Sna3p. Mol Biol Cell 18(5):1781-9	|CPS1 |RSP5 |SNA3 |TUL1
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Function/Process Mutants/Phenotypes	Hancock LC, et al. (2006) Genomic analysis of the Opi- phenotype. Genetics 173(2):621-34	|AGE2 |ALG9 |APL5 |APL6 |APM3 |APS3 |ARC18 |CHO2 |CKB2 |DEP1 |DID4 |EAF1 |EAF3 |EAF5 |MORE
Reviews	Shearwin-Whyatt L, et al. (2006) Regulation of functional diversity within the Nedd4 family by accessory and adaptor proteins. Bioessays 28(6):617-28	|BUL1 |BUL2 |CPS1 |GAP1 |PPN1 |RSP5 |TRE1 |TRE2 |TUL1
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Stimpson HE, et al. (2006) Transferrin receptor-like proteins control the degradation of a yeast metal transporter. EMBO J 25(4):662-72	|RSP5 |SMF1 |TRE1 |TRE2 |TUL1
Reviews	Culotta VC, et al. (2005) Manganese transport and trafficking: lessons learned from Saccharomyces cerevisiae. Eukaryot Cell 4(7):1159-65	|CCC1 |MAM3 |MTM1 |PER1 |PHO84 |PMR1 |SMF1 |SMF2 |SOD2
Protein-protein Interactions	Millson SH, et al. (2005) A two-hybrid screen of the yeast proteome for Hsp90 interactors uncovers a novel Hsp90 chaperone requirement in the activity of a stress-activated mitogen-activated protein kinase, Slt2p (Mpk1p). Eukaryot Cell 4(5):849-60	|ACF4 |ACT1 |AGP2 |AHA1 |AIM2 |AIM37 |ANT1 |AQR1 |ARE1 |ARE2 |ARG4 |ARR3 |ASG7 |ATG14 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Takahashi T, et al. (2005) A novel role for Bsd2 in the resistance of yeast to adriamycin. J Cell Physiol 202(1):100-4	|SMF1 |SMF2
Function/Process Mutants/Phenotypes Strains/Constructs	Valdez-Taubas J and Pelham H (2005) Swf1-dependent palmitoylation of the SNARE Tlg1 prevents its ubiquitination and degradation. EMBO J 24(14):2524-32	|AKR1 |AKR2 |ERF2 |PFA3 |PFA4 |PFA5 |SNC1 |SWF1 |SYN8 |TLG1 |TUL1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions Regulation of Regulatory Role Strains/Constructs	Hettema EH, et al. (2004) Bsd2 binds the ubiquitin ligase Rsp5 and mediates the ubiquitination of transmembrane proteins. EMBO J 23(6):1279-88	|CPS1 |PPN1 |RER1 |RSP5 |TUL1
Mutants/Phenotypes	Serrano R, et al. (2004) Copper and iron are the limiting factors for growth of the yeast Saccharomyces cerevisiae in an alkaline environment. J Biol Chem 279(19):19698-704	|AFT1 |ATX1 |BEM1 |BUD25 |CCC2 |CCS1 |COX17 |CTR1 |CUP5 |DIA2 |ERG2 |ERG6 |FET3 |FET4 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Protein Physical Properties Techniques and Reagents	Peng J, et al. (2003) A proteomics approach to understanding protein ubiquitination. Nat Biotechnol 21(8):921-6	|ACS2 |ADE13 |AKL1 |ALD6 |ARO10 |CCT8 |CDC48 |CHD1 |CHS3 |CIT2 |COS4 |CSR2 |CTR9 |CUE5 |MORE
Mutants/Phenotypes Strains/Constructs	Ran H, et al. (2003) Human targets of Pseudomonas aeruginosa pyocyanin. Proc Natl Acad Sci U S A 100(24):14315-20	|BNA2 |BUD30 |CAT5 |CCM1 |CDC50 |CLN2 |COQ1 |DOA4 |ERG24 |FEN1 |FIG2 |GAS1 |GET2 |MRPL17 |MORE
Function/Process Regulatory Role	Portnoy ME, et al. (2000) Saccharomyces cerevisiae expresses three functionally distinct homologues of the nramp family of metal transporters. Mol Cell Biol 20(21):7893-902	|SMF1 |SMF2 |SMF3
Mutants/Phenotypes Regulatory Role Strains/Constructs	Liu XF and Culotta VC (1999) Mutational analysis of Saccharomyces cerevisiae Smf1p, a member of the Nramp family of metal transporters. J Mol Biol 289(4):885-91	|SMF1
Mutants/Phenotypes Regulatory Role Strains/Constructs	Liu XF and Culotta VC (1999) Post-translation control of Nramp metal transport in yeast. Role of metal ions and the BSD2 gene. J Biol Chem 274(8):4863-8	|PEP4 |SMF1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Liu XF, et al. (1997) Negative control of heavy metal uptake by the Saccharomyces cerevisiae BSD2 gene. J Biol Chem 272(18):11763-9	|CTR1 |FET4 |SMF1 |SMF2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Luo W and Chang A (1997) Novel genes involved in endosomal traffic in yeast revealed by suppression of a targeting-defective plasma membrane ATPase mutant. J Cell Biol 138(4):731-46	|INP51 |INP52 |INP53 |KEX2 |MVP1 |PEP1 |PMA1 |SOP4 |VPS13 |VPS27 |VPS29 |VPS35 |VPS36 |VPS38 |MORE
Reviews	Moradas-Ferreira P, et al. (1996) The molecular defences against reactive oxygen species in yeast. Mol Microbiol 19(4):651-8	|GSH1 |SKN7 |SOD1 |TRX1 |TRX2
Genetic Interactions Mutants/Phenotypes	Culotta VC, et al. (1995) A physiological role for Saccharomyces cerevisiae copper/zinc superoxide dismutase in copper buffering. J Biol Chem 270(50):29991-7	|ATX1 |CUP1-1 |CUP1-2 |CUP2 |PMR1 |SOD1 |SOD2
Genetic Interactions Mutants/Phenotypes	Lapinskas PJ, et al. (1995) Mutations in PMR1 suppress oxidative damage in yeast cells lacking superoxide dismutase. Mol Cell Biol 15(3):1382-8	|PMR1 |SOD1
DNA/RNA Sequence Features Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs Transcription	Liu XF and Culotta VC (1994) The requirement for yeast superoxide dismutase is bypassed through mutations in BSD2, a novel metal homeostasis gene. Mol Cell Biol 14(11):7037-45	|PMR1 |SOD1

Return to SGD

Send a Message to the SGD Curators